WikiFur Statistics



DataWikifurriesArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
ago 20220%   0%0%     -20%0%0%0%0%0%0%0%
jul 20220% -20% 0%0%     -22%0%0%0%-0%0%0%0%
jun 20220%   0%0%     +64%0%0%0%0%0%0%0%
mai 20220%   0%0%     -18%0%0%0%0%0%0%0%
set 20222494     -691    10       
ago 20222493617121 k19 k116,5145564%17%66638 Mb4,9 M200 k4,3 k12 k82 k14 k
jul 20222487420121 k19 k 16,5145364%17%83738 Mb4,9 M200 k4,3 k12 k82 k14 k
jun 20222483625121 k19 k116,5145064%17%1,1 k38 Mb4,9 M199 k4,3 k11 k81 k14 k
mai 20222477318121 k19 k116,4144964%17%65638 Mb4,9 M199 k4,3 k11 k81 k14 k
abr 20222474316121 k19 k 16,4144764%17%79938 Mb4,9 M198 k4,3 k11 k81 k14 k
mar 20222471519221 k19 k116,4144664%17%1,2 k38 Mb4,9 M198 k4,3 k11 k81 k13 k
fev 2022246628 21 k19 k 16,3144564%17%42238 Mb4,9 M198 k4,3 k11 k81 k13 k
jan 20222464114121 k19 k116,3144364%17%51638 Mb4,9 M197 k4,3 k11 k81 k13 k
dez 20212463313 21 k19 k 16,3144264%17%39538 Mb4,9 M197 k4,3 k11 k80 k13 k
nov 20212460422221 k19 k 16,3144164%17%1,1 k38 Mb4,8 M197 k4,3 k11 k80 k13 k
out 20212456517 21 k19 k116,3144064%17%53838 Mb4,8 M197 k4,3 k11 k80 k13 k
set 20212451325120 k19 k216,3144064%17%83838 Mb4,8 M196 k4,2 k11 k80 k13 k
ago 20212448632120 k19 k116,3144064%17%96138 Mb4,8 M196 k4,2 k11 k80 k13 k
jul 20212442518120 k19 k 16,3144064%17%82937 Mb4,8 M195 k4,2 k11 k79 k13 k
jun 20212437320120 k19 k116,2143964%17%52237 Mb4,8 M195 k4,2 k11 k79 k13 k
mai 20212434310 20 k19 k 16,2143764%17%55837 Mb4,8 M194 k4,2 k11 k79 k13 k
abr 20212431218 20 k19 k116,2143664%17%45037 Mb4,8 M194 k4,2 k11 k79 k13 k
mar 20212429 13 20 k18 k 16,2143564%17%48937 Mb4,8 M194 k4,2 k11 k79 k13 k
fev 2021242938 20 k18 k 16,2143464%17%41037 Mb4,8 M194 k4,2 k11 k79 k13 k
jan 20212426113120 k18 k 16,2143064%17%60637 Mb4,8 M193 k4,2 k11 k79 k13 k
dez 20202425622120 k18 k116,2142864%17%74837 Mb4,8 M193 k4,2 k11 k78 k13 k
nov 20202419115220 k18 k 16,1142764%17%71537 Mb4,7 M192 k4,2 k11 k78 k13 k
out 20202418523 20 k18 k116,1142564%17%68437 Mb4,7 M192 k4,2 k11 k78 k13 k
set 20202413416 20 k18 k116,1142264%17%71237 Mb4,7 M191 k4,2 k11 k78 k13 k
ago 20202409616 20 k18 k116,1142164%17%56537 Mb4,7 M191 k4,2 k11 k78 k13 k
jul 20202403419120 k18 k116,1141864%17%78037 Mb4,7 M191 k4,2 k11 k78 k13 k
jun 20202399215120 k18 k116,1141664%17%68237 Mb4,7 M190 k4,2 k11 k77 k13 k
mai 20202397632120 k18 k116,0141464%17%90936 Mb4,7 M190 k4,2 k11 k77 k13 k
abr 20202391524120 k18 k116,0141363%17%73736 Mb4,7 M189 k4,2 k11 k77 k13 k
mar 20202386320 20 k18 k116,0141263%17%62036 Mb4,7 M189 k4,2 k11 k77 k13 k
fev 20202383431120 k18 k116,0141063%16%1,2 k36 Mb4,6 M189 k4,2 k11 k77 k13 k
jan 20202379628120 k18 k116,0140663%16%1,0 k36 Mb4,6 M188 k4,2 k11 k76 k13 k
dez 20192373320120 k18 k515,9140563%16%1,8 k36 Mb4,6 M188 k4,2 k11 k76 k13 k
nov 20192370416120 k18 k216,0141364%17%1,7 k36 Mb4,6 M187 k4,2 k11 k76 k13 k
out 20192366721 20 k18 k 15,9140964%16%63236 Mb4,6 M186 k4,2 k11 k75 k13 k
set 20192359326 20 k18 k115,9140763%16%81736 Mb4,6 M186 k4,2 k11 k75 k13 k
ago 20192356326120 k18 k115,9140763%16%83636 Mb4,6 M186 k4,2 k11 k75 k13 k
jul 20192353632 20 k18 k115,9140663%16%85135 Mb4,6 M185 k4,2 k11 k75 k13 k
jun 20192347417120 k18 k115,8140563%16%72335 Mb4,5 M185 k4,2 k11 k75 k13 k
mai 20192343922120 k18 k115,8140363%16%78135 Mb4,5 M185 k4,2 k11 k75 k13 k
abr 20192334417120 k18 k115,8140163%16%97735 Mb4,5 M184 k4,2 k11 k74 k13 k
mar 20192330623120 k18 k115,8139863%16%1,1 k35 Mb4,5 M183 k4,2 k11 k74 k13 k
fev 20192324528120 k18 k115,8139563%16%87435 Mb4,5 M183 k4,2 k11 k74 k13 k
jan 20192319321120 k18 k115,7139463%16%70035 Mb4,5 M182 k4,2 k10 k73 k13 k
dez 20182316525 20 k18 k115,7139263%16%62235 Mb4,5 M182 k4,2 k10 k73 k13 k
nov 20182311320 19 k18 k115,7138963%16%48835 Mb4,5 M182 k4,2 k10 k73 k13 k
out 20182308514 19 k18 k115,7138863%16%50035 Mb4,4 M181 k4,2 k10 k73 k13 k
set 20182303420 19 k18 k115,7138763%16%80135 Mb4,4 M181 k4,2 k10 k72 k13 k
ago 20182299620 19 k18 k115,7138763%16%52934 Mb4,4 M181 k4,2 k10 k72 k13 k
jul 20182293323 19 k18 k115,7138663%16%48434 Mb4,4 M180 k4,2 k10 k72 k13 k
jun 20182290119 19 k18 k115,7138563%16%58434 Mb4,4 M180 k4,2 k10 k72 k13 k
mai 20182289325119 k18 k215,6138463%16%76434 Mb4,4 M180 k4,2 k10 k72 k12 k
abr 20182286527 19 k18 k115,6138263%16%84334 Mb4,4 M179 k4,2 k10 k71 k12 k
mar 20182281421 19 k17 k115,6138163%16%60234 Mb4,4 M179 k4,2 k10 k71 k12 k
fev 20182277624119 k17 k115,6138063%16%66034 Mb4,4 M178 k4,2 k10 k71 k12 k
jan 20182271625119 k17 k115,6137963%16%75434 Mb4,4 M178 k4,2 k10 k71 k12 k
dez 201722651125 19 k17 k115,6137763%16%65834 Mb4,3 M177 k4,1 k10 k70 k12 k
nov 20172254422 19 k17 k115,6137563%16%55034 Mb4,3 M177 k4,1 k10 k70 k12 k
out 20172250424 19 k17 k215,6137563%16%71734 Mb4,3 M176 k4,1 k10 k70 k12 k
set 20172246523 19 k17 k115,6137263%16%63234 Mb4,3 M176 k4,1 k10 k70 k12 k
ago 20172241618 19 k17 k115,6137263%16%63033 Mb4,3 M176 k4,1 k10 k69 k12 k
jul 20172235519 19 k17 k115,6137163%16%72633 Mb4,3 M175 k4,1 k10,0 k69 k12 k
jun 20172230621119 k17 k215,6136963%16%84033 Mb4,3 M175 k4,1 k9,9 k69 k12 k
mai 20172224528119 k17 k215,6136762%16%1,0 k33 Mb4,2 M174 k4,1 k9,9 k68 k12 k
abr 20172219427219 k17 k315,6136662%16%1,3 k33 Mb4,2 M173 k4,1 k9,8 k68 k12 k
mar 201722151125 19 k17 k315,6136462%16%94133 Mb4,2 M173 k4,0 k9,8 k67 k12 k
fev 201722041129219 k17 k315,6136462%16%1,2 k33 Mb4,2 M172 k4,0 k9,8 k66 k12 k
jan 20172193829219 k17 k315,6136462%16%1,2 k32 Mb4,2 M171 k3,9 k9,7 k66 k12 k
dez 20162185318118 k17 k215,7136562%16%1,0 k32 Mb4,2 M170 k3,8 k9,7 k65 k12 k
nov 20162182423218 k17 k215,7136362%16%82932 Mb4,1 M169 k3,7 k9,6 k65 k12 k
out 20162178416 18 k17 k115,7136362%16%45632 Mb4,1 M169 k3,7 k9,6 k65 k12 k
set 20162174513 18 k17 k115,6136262%16%48332 Mb4,1 M169 k3,7 k9,6 k64 k12 k
ago 20162169219118 k17 k115,6136162%16%65332 Mb4,1 M168 k3,7 k9,5 k64 k12 k
jul 20162167721118 k16 k115,6136162%16%88632 Mb4,1 M168 k3,7 k9,5 k64 k12 k
jun 20162160326118 k16 k115,6136062%16%92032 Mb4,1 M168 k3,7 k9,5 k64 k12 k
mai 20162157321118 k16 k115,6135862%16%71532 Mb4,1 M168 k3,6 k9,6 k64 k12 k
abr 20162154726118 k16 k215,6135762%16%86932 Mb4,1 M167 k3,6 k9,4 k64 k12 k
mar 201621471129218 k16 k115,6135762%16%1,1 k32 Mb4,1 M167 k3,6 k9,4 k63 k12 k
fev 20162136220 18 k16 k115,5135462%16%82431 Mb4,0 M166 k3,6 k9,4 k63 k12 k
jan 20162134428318 k16 k215,5135262%16%1,2 k31 Mb4,0 M165 k3,6 k9,4 k63 k12 k
dez 20152130118 18 k16 k115,5133762%16%63331 Mb4,0 M165 k3,6 k9,3 k62 k12 k
nov 20152129318118 k16 k115,5133662%15%80531 Mb4,0 M164 k3,5 k9,3 k62 k12 k
out 20152126322118 k16 k115,5133461%15%92531 Mb3,9 M164 k3,5 k9,3 k62 k12 k
set 20152123314118 k16 k215,5133261%15%95331 Mb3,9 M163 k3,5 k9,2 k61 k12 k
ago 20152120818218 k16 k215,5133061%15%1,1 k30 Mb3,9 M162 k3,5 k9,2 k61 k12 k
jul 20152112420218 k16 k215,4132561%15%1,1 k30 Mb3,9 M161 k3,4 k9,2 k60 k12 k
jun 20152108429318 k16 k215,4132461%15%1,2 k30 Mb3,9 M160 k3,4 k9,1 k60 k11 k
mai 20152104522318 k16 k215,4132261%15%1,3 k30 Mb3,9 M159 k3,4 k9,0 k59 k11 k
abr 20152099722218 k16 k215,4132161%15%1,0 k30 Mb3,8 M158 k3,3 k9,0 k59 k11 k
mar 20152092522118 k16 k215,4132061%15%83830 Mb3,8 M158 k3,3 k9,0 k59 k11 k
fev 20152087318 18 k16 k115,4131861%15%74230 Mb3,8 M157 k3,3 k8,9 k58 k11 k
jan 20152084824 17 k16 k215,3131761%15%92230 Mb3,8 M156 k3,2 k8,9 k58 k11 k
dez 20142076422217 k16 k115,3131761%15%1,1 k29 Mb3,8 M156 k3,2 k8,9 k58 k11 k
nov 20142072228217 k16 k115,3131560%15%1,1 k29 Mb3,8 M155 k3,1 k8,8 k57 k11 k
out 20142070926317 k16 k215,3131460%15%1,3 k29 Mb3,8 M154 k3,0 k8,8 k57 k11 k
set 20142061726217 k15 k115,3131160%15%1,1 k29 Mb3,7 M153 k3,0 k8,7 k57 k11 k
ago 20142054323217 k15 k215,2131060%15%1,0 k29 Mb3,7 M152 k3,0 k8,7 k56 k11 k
jul 20142051524317 k15 k115,2130860%15%1,1 k29 Mb3,7 M151 k2,9 k8,7 k56 k11 k
jun 20142046522317 k15 k215,2130960%15%1,2 k29 Mb3,7 M151 k2,9 k8,6 k56 k11 k
mai 20142041321217 k15 k215,2130860%15%87829 Mb3,7 M150 k2,9 k8,6 k55 k11 k
abr 20142038526317 k15 k115,2130860%15%1,3 k29 Mb3,7 M149 k2,9 k8,5 k55 k11 k
mar 20142033928217 k15 k215,1130660%15%1,2 k28 Mb3,7 M148 k2,9 k8,5 k54 k11 k
fev 20142024315217 k15 k315,1130559%15%99028 Mb3,7 M147 k2,9 k8,4 k54 k11 k
jan 20142021625317 k15 k415,1130559%15%1,4 k28 Mb3,6 M146 k2,9 k8,4 k53 k11 k
dez 20132015521317 k15 k215,2130559%15%1,0 k28 Mb3,6 M144 k2,9 k8,3 k52 k11 k
nov 20132010422317 k15 k315,2130559%15%1,1 k28 Mb3,6 M143 k2,9 k8,3 k52 k11 k
out 20132006622417 k15 k415,2130359%15%1,9 k28 Mb3,6 M142 k2,9 k8,3 k52 k11 k
set 20132000427216 k15 k315,2130359%15%1,4 k27 Mb3,6 M141 k2,8 k8,2 k51 k11 k
ago 20131996522316 k15 k315,2129859%15%1,4 k27 Mb3,5 M140 k2,8 k8,1 k50 k10 k
jul 20131991522316 k14 k515,2129859%15%1,8 k27 Mb3,5 M138 k2,7 k8,1 k50 k10 k
jun 20131986830416 k14 k615,2130559%15%2,9 k27 Mb3,5 M137 k2,7 k8,0 k50 k10 k
mai 201319781029316 k14 k415,2130959%15%2,1 k27 Mb3,5 M135 k2,7 k7,9 k49 k10 k
abr 20131968329516 k14 k315,2130859%15%2,5 k26 Mb3,4 M134 k2,6 k7,8 k47 k10 k
mar 20131965929516 k14 k615,1130858%15%2,0 k26 Mb3,4 M132 k2,6 k7,8 k47 k9,9 k
fev 20131956324316 k14 k415,1131158%15%1,3 k26 Mb3,4 M130 k2,6 k7,7 k46 k9,9 k
jan 201319531449515 k14 k615,2131258%16%2,4 k26 Mb3,4 M128 k2,5 k7,7 k45 k9,8 k
dez 201219391435515 k13 k315,2131858%16%2,1 k25 Mb3,3 M126 k2,5 k7,7 k44 k9,7 k
nov 20121925931415 k13 k415,2132058%16%1,7 k25 Mb3,3 M125 k2,4 k7,7 k43 k9,6 k
out 201219161131315 k13 k715,2132158%16%2,1 k25 Mb3,3 M124 k2,4 k7,6 k43 k9,6 k
set 20121905939315 k13 k415,2132558%16%1,9 k25 Mb3,3 M121 k2,4 k7,5 k42 k9,5 k
ago 20121896935215 k13 k315,2132758%16%1,6 k25 Mb3,3 M120 k2,4 k7,4 k41 k9,4 k
jul 201218871040315 k13 k615,2132758%16%1,9 k24 Mb3,2 M119 k2,3 k7,3 k41 k9,4 k
jun 20121877634214 k13 k415,3133258%16%1,7 k24 Mb3,2 M118 k2,3 k7,3 k40 k9,3 k
mai 201218711033314 k13 k415,3133558%16%1,8 k24 Mb3,2 M116 k2,3 k7,3 k39 k9,2 k
abr 20121861326314 k12 k515,3133658%16%1,7 k24 Mb3,2 M115 k2,3 k7,2 k38 k9,1 k
mar 201218581546414 k12 k415,4134058%16%2,3 k24 Mb3,1 M113 k2,3 k7,2 k38 k9,1 k
fev 201218431036214 k12 k315,3134358%16%1,8 k23 Mb3,1 M112 k2,3 k7,1 k37 k8,9 k
jan 201218331438614 k12 k615,3134459%16%2,7 k23 Mb3,1 M111 k2,3 k7,0 k37 k8,8 k
dez 201118191537314 k12 k515,3134459%16%1,6 k23 Mb3,1 M109 k2,3 k6,9 k36 k8,8 k
nov 201118041135413 k12 k515,4135159%16%1,7 k23 Mb3,0 M108 k2,2 k6,9 k36 k8,7 k
out 201117931245513 k12 k715,4135359%17%2,2 k22 Mb3,0 M107 k2,2 k6,8 k35 k8,6 k
set 201117811042313 k12 k415,5136359%17%1,8 k22 Mb3,0 M105 k2,2 k6,8 k34 k8,5 k
ago 201117711252413 k11 k715,5136859%17%2,8 k22 Mb3,0 M104 k2,2 k6,7 k34 k8,4 k
jul 201117591749513 k11 k315,6137560%17%2,6 k22 Mb2,9 M103 k2,0 k6,7 k33 k8,3 k
jun 201117421443313 k11 k515,5137360%17%2,8 k22 Mb2,9 M102 k2,0 k6,6 k33 k8,2 k
mai 20111728952213 k11 k415,4136560%17%2,1 k21 Mb2,9 M101 k2,0 k6,5 k32 k8,0 k
abr 20111719854112 k11 k415,4136660%17%1,9 k21 Mb2,8 M100 k1,9 k6,4 k32 k7,9 k
mar 20111711944312 k11 k215,4136660%17%1,9 k21 Mb2,8 M98 k1,9 k6,4 k31 k7,8 k
fev 20111702947112 k11 k215,3136360%17%1,5 k21 Mb2,8 M98 k1,9 k6,3 k31 k7,7 k
jan 201116931550212 k11 k315,3135760%17%1,9 k21 Mb2,8 M97 k1,9 k6,3 k31 k7,7 k
dez 201016781530212 k11 k215,2135960%17%1,3 k21 Mb2,8 M96 k1,9 k6,2 k30 k7,6 k
nov 20101663948312 k11 k315,2135660%17%1,6 k20 Mb2,7 M96 k1,8 k6,2 k30 k7,6 k
out 201016541241112 k11 k215,2135260%17%1,5 k20 Mb2,7 M95 k1,8 k6,1 k29 k7,6 k
set 201016421051212 k11 k415,1134660%17%1,7 k20 Mb2,7 M94 k1,8 k6,1 k29 k7,5 k
ago 201016322347212 k10 k315,1134560%17%2,0 k20 Mb2,7 M93 k1,8 k6,0 k29 k7,5 k
jul 201016091564112 k10 k315,1134460%17%2,2 k20 Mb2,6 M93 k1,8 k5,9 k28 k7,5 k
jun 201015942150 12 k10 k315,0133860%17%1,6 k19 Mb2,6 M92 k1,8 k5,9 k28 k7,4 k
mai 201015731342211 k10 k215,0132660%17%1,5 k19 Mb2,6 M91 k1,7 k5,8 k28 k7,4 k
abr 201015601235311 k10 k315,0130859%16%1,5 k19 Mb2,5 M90 k1,7 k5,8 k27 k7,3 k
mar 20101548751311 k10 k314,9129959%16%1,7 k18 Mb2,5 M89 k1,7 k5,8 k27 k7,3 k
fev 201015411354411 k10,0 k314,9130059%16%1,8 k18 Mb2,4 M89 k1,6 k5,7 k27 k7,2 k
jan 20101528537211 k9,9 k314,9129559%16%1,7 k18 Mb2,4 M88 k1,6 k5,6 k26 k7,2 k
dez 200915231353111 k9,8 k214,8129659%16%1,6 k18 Mb2,4 M87 k1,6 k5,6 k26 k7,1 k
nov 200915101547311 k9,8 k414,8129259%16%1,9 k18 Mb2,4 M87 k1,6 k5,5 k26 k7,1 k
out 200914951455111 k9,7 k314,7128559%16%1,8 k17 Mb2,3 M86 k1,5 k5,5 k25 k7,0 k
set 200914811464311 k9,6 k314,7128059%16%2,1 k17 Mb2,3 M85 k1,5 k5,4 k25 k6,9 k
ago 200914671958311 k9,5 k214,6127559%16%2,3 k17 Mb2,3 M85 k1,5 k5,4 k25 k6,9 k
jul 200914482471411 k9,4 k314,5127059%16%2,5 k17 Mb2,3 M84 k1,5 k5,4 k24 k6,8 k
jun 200914242172411 k9,4 k514,4126559%16%2,8 k17 Mb2,2 M83 k1,4 k5,3 k24 k6,8 k
mai 200914031963510 k9,2 k514,3126559%15%2,6 k16 Mb2,2 M83 k1,3 k5,2 k24 k6,7 k
abr 200913841667210 k9,1 k614,3126159%15%2,6 k16 Mb2,2 M81 k1,3 k5,1 k23 k6,7 k
mar 200913682264310 k8,9 k414,3126558%16%2,6 k16 Mb2,1 M80 k1,2 k5,1 k23 k6,6 k
fev 20091346165029,9 k8,8 k414,2126258%16%2,0 k16 Mb2,1 M79 k1,1 k5,0 k22 k6,5 k
jan 20091330338149,8 k8,7 k614,2126358%16%3,3 k15 Mb2,1 M78 k1,1 k5,0 k22 k6,5 k
dez 20081297307959,6 k8,5 k714,1126458%16%4,1 k15 Mb2,0 M77 k9814,9 k21 k6,3 k
nov 20081267266549,4 k8,3 k714,0127158%15%2,7 k15 Mb2,0 M75 k8604,8 k21 k6,2 k
out 20081241236559,2 k8,2 k514,0127959%15%3,3 k15 Mb2,0 M74 k7284,7 k20 k6,1 k
set 20081218216139,1 k8,0 k213,9127859%15%2,5 k14 Mb1,9 M72 k4354,6 k20 k6,0 k
ago 20081197226949,0 k8,0 k713,7126659%15%3,1 k14 Mb1,9 M72 k4194,5 k19 k5,9 k
jul 20081175297068,8 k7,8 k513,7126759%15%3,1 k14 Mb1,9 M70 k4094,5 k19 k5,8 k
jun 20081146247638,6 k7,7 k413,6126759%15%2,5 k14 Mb1,8 M69 k3974,4 k18 k5,7 k
mai 20081122318048,5 k7,5 k413,5126058%15%2,7 k13 Mb1,8 M68 k3904,3 k18 k5,6 k
abr 20081091246348,4 k7,4 k513,3126058%15%2,6 k13 Mb1,8 M67 k3904,2 k17 k5,5 k
mar 20081067156038,2 k7,3 k513,3125358%15%2,1 k13 Mb1,7 M66 k3824,1 k17 k5,3 k
fev 20081052196838,1 k7,2 k613,2125359%15%2,3 k13 Mb1,7 M64 k3724,0 k16 k5,2 k
jan 20081033246447,9 k7,0 k413,2125859%15%2,4 k12 Mb1,7 M63 k3464,0 k16 k5,1 k
dez 20071009215737,8 k6,9 k513,2125359%15%2,1 k12 Mb1,6 M62 k2953,9 k16 k5,1 k
nov 2007988227647,7 k6,8 k613,1125259%15%2,8 k12 Mb1,6 M61 k2913,8 k15 k5,0 k
out 2007966347247,5 k6,6 k513,1125359%15%2,5 k12 Mb1,6 M60 k1553,7 k15 k4,8 k
set 2007932236847,3 k6,5 k513,0125059%15%2,7 k11 Mb1,5 M59 k913,5 k14 k4,8 k
ago 2007909297557,2 k6,4 k612,9124659%15%3,1 k11 Mb1,5 M57 k793,4 k14 k4,6 k
jul 2007880319487,0 k6,2 k712,8122058%14%3,5 k11 Mb1,4 M54 k523,3 k14 k4,4 k
jun 2007849338476,8 k6,0 k912,6121658%14%4,0 k10 Mb1,4 M52 k443,1 k13 k4,3 k
mai 2007816287746,5 k5,8 k612,5122459%15%3,7 k9,8 Mb1,3 M49 k412,9 k12 k4,0 k
abr 2007788337756,3 k5,6 k712,3122259%14%3,9 k9,5 Mb1,3 M47 k392,8 k12 k3,8 k
mar 2007755408636,1 k5,4 k612,1122359%14%3,6 k9,2 Mb1,2 M45 k342,7 k12 k3,7 k
fev 2007715368655,9 k5,2 k711,9121459%14%3,3 k8,8 Mb1,2 M43 k312,5 k11 k3,6 k
jan 2007679318175,8 k5,1 k611,7120358%14%3,9 k8,5 Mb1,2 M41 k212,3 k11 k3,5 k
dez 2006648408275,6 k4,9 k811,4118858%14%3,9 k8,1 Mb1,1 M40 k212,2 k10 k3,3 k
nov 2006608296555,3 k4,6 k811,2116957%13%3,0 k7,6 Mb1,0 M38 k171,9 k9,5 k3,1 k
out 2006579337455,1 k4,4 k1111,2117457%13%4,2 k7,2 Mb993 k36 k151,8 k9,0 k3,0 k
set 2006546436954,7 k4,1 k1111,1118257%13%3,4 k6,8 Mb932 k34 k151,7 k8,3 k2,8 k
ago 2006503327084,4 k3,9 k911,1117758%13%4,0 k6,3 Mb864 k32 k151,6 k7,6 k2,6 k
jul 2006471468384,1 k3,7 k1210,9118758%13%4,9 k5,9 Mb817 k30 k151,4 k7,0 k2,5 k
jun 2006425326253,8 k3,4 k1110,6120759%14%3,5 k5,4 Mb758 k28 k141,2 k6,2 k2,2 k
mai 2006393376553,4 k3,1 k610,6120859%14%3,1 k4,9 Mb689 k25 k61,0 k5,6 k2,1 k
abr 2006356345453,2 k2,9 k810,3118059%13%3,7 k4,5 Mb634 k24 k68975,1 k1,9 k
mar 20063227813073,0 k2,7 k910,0118159%13%5,1 k4,2 Mb585 k22 k57934,6 k1,8 k
fev 2006244263832,7 k2,4 k79,2118359%13%1,9 k3,7 Mb530 k19 k47124,1 k1,7 k
jan 2006218275242,5 k2,2 k69,1118560%13%2,7 k3,5 Mb492 k18 k46463,7 k1,6 k
dez 2005191173942,3 k2,0 k68,7113658%12%2,4 k3,0 Mb435 k16 k45673,3 k1,4 k
nov 2005174334472,1 k1,9 k88,3113657%12%3,7 k2,8 Mb400 k14 k45012,9 k1,2 k
out 2005141113251,9 k1,6 k127,5112454%12%2,8 k2,4 Mb348 k12 k24282,5 k1,0 k
set 2005130285051,5 k1,3 k177,5114454%13%4,1 k1,9 Mb285 k9,1 k23272,1 k820
ago 20051021009611999850327,1115654%12%7,0 k1,3 Mb194 k5,6 k22241,5 k469
jul 2005221 109 5,8161760%20%5722 kb2,6 k102 25911
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikifurriesArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikifurries (usuários registrados)
A = Wikifurries que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikifurries que editaram pelo menos dez vezes desde que chegaram
C = Wikifurries que contribuíram cinco vezes ou mais este mês
D = Wikifurries que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total number of links to WikiFur sites in other languages
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

Distribuição de edições de artigos por wikifurries
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

1 : 3 : 10 : 32 : 100 : 316 : 1000 ... = 1 : √10 : 10 : 10√10 : 100 : 100√10 : 1000 ...

Edições >=WikifurriesEdições total


49 wikifurries recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias

UsuárioEdiçõesPrimeira edição
30 dias
30 dias
GreenReaper1 0424988227381jul 28, 20056272
Spirou4 0152214281115556ago 18, 20056252
EarthFurst5 0610062392414fev 14, 20066072
Mwalimu11 06452935582ago 18, 20056252
Tai_114 0151942284 jul 02, 20085202
AlexanderGrey15 0141922183111jul 12, 20065924
BlueOtter20 016119156614ago 16, 20056254
Mld7424+228734773fev 07, 20172061
Dokatamaru27 02638119 mar 26, 20104571
Novaaa85+2118559 mar 11, 20181663
Polymorphic102 0215578 fev 12, 20181691
Shetani120+26191364517ago 12, 20171875
AmyFoxx166+3110637 jan 31, 20114260
Lucashoal195+419032 ago 15, 20056255
Silverfoxwolf213+82845 out 03, 20114015
SouthPaw224+18381612fev 12, 20066073
WhiteTigerOfTheWest243+5279311jan 02, 20201002
SpotsDalmatian246+937810 jan 30, 20085357
Whit_McClendon254+10376533ago 23, 202238
Keenora270+117025 abr 04, 20075658
Drraccoon308+81628 nov 16, 20113971
Freaky_Lynx456+111456 mar 11, 20085316
Dogman15476+292438 set 07, 20075502
Furryhuskyjj495+181942148out 25, 20142897
JadeBleufox606+4623616 set 27, 20123655
Aurifer744+662316 ago 13, 20181509
JKami810+58229203out 18, 20133269
ColtynPhD874+1363274 ago 18, 202242
Thunzeest_Wolf971+35262582mar 28, 2022186
Chevron973+4123212594jul 18, 202274
TylerFurrison1238+1772209 jul 01, 20191187
Taigitsune1396+8811814 abr 23, 20114178
BradleyCohen1411+2853181 abr 12, 20171997
ACFI1413+861183 mai 06, 20171972
Vuzeo1601...16161212set 21, 20229
Stalkaz_the_Stallion1705+1181156 mai 23, 2020859
ArtsyCat1831+6544142 mar 06, 2022208
Aatheus1951+14911333dez 09, 2020659
Techno_Blueberry2260+4412113 ago 23, 2020767
Who-is-Page2262+4482115 dez 01, 2021303
Phoenix_Martius2263+223111  abr 21, 2022162
Hālian2266+74431151ago 13, 202247
Lildobe2528+537294 dez 14, 20065769
Arxl2622+94239  fev 08, 20114252
NoSoul2714+288196 ago 15, 2021411
Zorilita3010+51646811jan 18, 2022255
Rehdyn3016+101067811ago 20, 202241
Smugdoggo3017...8844set 25, 20225
Kamen_rider_saber_the_furry_hater,_furries_are_gay_as_fuck!3774...66  set 14, 202216


2 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

UsuárioEdiçõesPrimeira ediçãoúltima edição
ReaperBot11466out 16, 20085097mar 03, 20143133
AtteBot2889out 20, 20085092fev 12, 20104613


20 wikifurries recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

UsuárioEdiçõesPrimeira ediçãoúltima edição
Higgs_Raccoon223679ago 26, 20065879jul 17, 20181535
Sine322281fev 10, 20066075set 01, 20191124
Equivamp66098nov 20, 20104332jul 29, 202263
Rat74874ago 26, 20056244jun 25, 202296
RayneVanDunem84850dez 12, 20075405jul 15, 20191173
SpazKitty94609fev 25, 20066060mar 23, 2021556
KendricksRedtail104591abr 01, 20066026ago 16, 20094792
Dmuth123102ago 07, 20056263set 21, 20104391
Tabyhunterwolf132598nov 04, 20191061out 03, 2020727
Frizzy161596abr 09, 20066018ago 12, 20075528
Bezel171353out 12, 20065832fev 14, 20172054
DuncanDaHusky181278ago 15, 20056255ago 23, 2020768
V._CA191228fev 29, 20162405abr 18, 2022164
Sebkha211153ago 28, 20056242mai 31, 20162312
Unci22919nov 02, 20056176nov 17, 2021317
RVDDP250123852jun 04, 20065962dez 30, 20142830
Siege25718out 31, 20056178fev 22, 20094967
MKerris26709out 13, 20056195mar 06, 20075687
Reaux28593abr 23, 20085273dez 07, 2020661
Atte29505fev 18, 20085338nov 10, 20133246


10 usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.


No total 70370 edições foram feitas por usuários anônimos, de um total de 342581 edições ( 20e %)

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 b< 64 b< 128 b< 256 b< 512 b< 1 kb< 2 kb< 4 kb< 8 kb< 16 kb< 32 kb< 64 kb
set 20220.1%0.3%3.0%14.0%35.8%63.0%82.9%93.6%98.1%99.6%100.0%100.0%
ago 20220.1%0.3%3.0%14.0%35.8%63.0%82.9%93.6%98.1%99.7%100.0%100.0%
jul 20220.1%0.3%3.0%14.0%35.8%63.0%82.9%93.5%98.0%99.6%100.0%100.0%
jun 20220.1%0.3%3.0%14.0%35.8%63.1%83.0%93.6%98.1%99.6%100.0%100.0%
mai 20220.1%0.3%3.0%14.0%35.9%63.1%83.0%93.6%98.0%99.5%99.9%100.0%
abr 20220.1%0.3%3.0%14.1%36.0%63.3%83.2%93.8%98.2%99.7%100.0%100.0%
mar 20220.1%0.3%3.0%14.1%36.0%63.2%83.1%93.7%98.1%99.6%100.0%100.0%
fev 20220.1%0.3%3.0%14.1%36.0%63.2%83.1%93.7%98.1%99.6%100.0%100.0%
jan 20220.1%0.3%3.0%14.1%36.0%63.2%83.1%93.7%98.1%99.6%100.0%100.0%
dez 20210.1%0.3%3.0%14.1%36.0%63.3%83.1%93.7%98.1%99.6%100.0%100.0%
nov 20210.1%0.3%3.0%14.1%36.0%63.3%83.1%93.6%98.0%99.5%99.9%100.0%
out 20210.1%0.3%3.0%14.1%36.1%63.4%83.2%93.7%98.1%99.6%100.0%100.0%
set 20210.1%0.3%3.0%14.1%36.1%63.3%83.1%93.6%98.0%99.5%99.9%100.0%
ago 20210.1%0.3%3.0%14.2%36.2%63.4%83.2%93.7%98.1%99.6%100.0%100.0%
jul 20210.0%0.2%2.9%14.1%36.0%63.2%83.0%93.5%97.9%99.4%99.8%99.9%
jun 20210.0%0.2%2.9%14.1%36.1%63.3%83.1%93.6%98.0%99.5%99.9%100.0%
mai 20210.0%0.2%2.9%14.1%36.1%63.3%83.1%93.6%98.0%99.5%99.9%100.0%
abr 20210.0%0.2%2.9%14.1%36.1%63.3%83.1%93.6%98.0%99.5%99.9%100.0%
mar 20210.0%0.2%2.9%14.2%36.2%63.4%83.2%93.6%98.0%99.5%99.9%100.0%
fev 20210.0%0.2%2.9%14.2%36.2%63.4%83.3%93.7%98.1%99.6%100.0%100.0%
jan 20210.0%0.2%2.9%14.2%36.2%63.4%83.3%93.7%98.0%99.5%99.9%100.0%
dez 20200.0%0.2%2.9%14.2%36.2%63.4%83.2%93.6%97.9%99.4%99.8%99.9%
nov 20200.0%0.2%2.9%14.2%36.2%63.4%83.2%93.6%97.9%99.4%99.8%99.9%
out 20200.0%0.2%2.9%14.2%36.3%63.4%83.2%93.6%97.9%99.4%99.8%99.9%
set 20200.0%0.2%3.0%14.4%36.5%63.6%83.4%93.8%98.1%99.6%100.0%100.0%
ago 20200.0%0.2%3.0%14.4%36.5%63.7%83.5%93.9%98.2%99.7%100.0%100.0%
jul 20200.0%0.2%3.0%14.4%36.5%63.7%83.5%93.9%98.2%99.7%100.0%100.0%
jun 20200.0%0.2%3.0%14.4%36.5%63.7%83.4%93.7%98.0%99.5%99.9%100.0%
mai 20200.0%0.2%3.0%14.4%36.5%63.7%83.5%93.8%98.1%99.6%100.0%100.0%
abr 20200.0%0.2%3.0%14.4%36.6%63.8%83.5%93.8%98.1%99.6%100.0%100.0%
mar 20200.0%0.2%3.0%14.4%36.6%63.7%83.4%93.7%98.0%99.5%99.9%100.0%
fev 20200.0%0.2%3.0%14.5%36.7%63.8%83.5%93.8%98.1%99.6%100.0%100.0%
jan 20200.0%0.2%3.0%14.5%36.8%64.0%83.7%93.9%98.2%99.7%100.0%100.0%
dez 20190.0%0.2%3.0%14.5%36.8%64.0%83.7%93.9%98.2%99.7%100.0%100.0%
nov 20190.0%0.2%2.9%14.3%36.5%63.8%83.6%93.8%98.1%99.6%100.0%100.0%
out 20190.0%0.2%2.9%14.3%36.6%63.9%83.7%93.9%98.2%99.7%100.0%100.0%
set 20190.0%0.2%2.9%14.3%36.6%63.9%83.6%93.8%98.1%99.6%100.0%100.0%
ago 20190.0%0.2%2.9%14.3%36.6%63.9%83.6%93.8%98.1%99.6%100.0%100.0%
jul 20190.0%0.2%2.9%14.3%36.6%63.9%83.6%93.8%98.1%99.6%100.0%100.0%
jun 20190.0%0.2%2.9%14.3%36.6%63.9%83.6%93.8%98.1%99.6%100.0%100.0%
mai 20190.0%0.2%2.9%14.3%36.7%64.1%83.7%93.8%98.1%99.6%100.0%100.0%
abr 20190.0%0.2%2.9%14.3%36.7%64.1%83.7%93.8%98.1%99.6%100.0%100.0%
mar 20190.0%0.2%2.9%14.3%36.8%64.2%83.8%93.9%98.1%99.6%100.0%100.0%
fev 20190.0%0.2%3.0%14.4%36.9%64.3%83.9%94.0%98.2%99.7%100.0%100.0%
jan 20190.0%0.2%3.0%14.4%36.9%64.3%83.9%93.9%98.1%99.6%99.9%100.0%
dez 20180.0%0.2%3.0%14.4%37.0%64.4%83.9%93.9%98.1%99.6%99.9%100.0%
nov 20180.0%0.2%3.0%14.5%37.1%64.6%84.1%94.1%98.3%99.8%100.0%100.0%
out 20180.0%0.1%2.9%14.4%37.0%64.5%84.0%93.9%98.1%99.6%99.9%100.0%
set 20180.0%0.1%2.9%14.4%37.0%64.5%84.0%93.9%98.1%99.6%99.9%100.0%
ago 20180.0%0.1%2.9%14.4%37.0%64.5%84.0%93.9%98.1%99.6%99.9%100.0%
jul 20180.0%0.1%2.9%14.4%37.1%64.6%84.1%93.9%98.1%99.6%99.9%100.0%
jun 20180.0%0.1%2.9%14.4%37.1%64.6%84.1%93.9%98.1%99.6%99.9%100.0%
mai 20180.0%0.1%2.9%14.4%37.1%64.6%84.2%94.0%98.1%99.6%99.9%100.0%
abr 20180.0%0.1%2.9%14.4%37.0%64.5%84.0%93.8%97.9%99.4%99.7%99.8%
mar 20180.0%0.1%2.9%14.4%37.0%64.5%84.0%93.8%97.9%99.4%99.7%99.8%
fev 20180.0%0.1%2.9%14.5%37.1%64.7%84.2%94.0%98.1%99.6%99.9%100.0%
jan 20180.0%0.1%3.0%14.6%37.2%64.8%84.2%94.0%98.1%99.5%99.8%99.9%
dez 20170.0%0.1%3.0%14.6%37.3%64.8%84.2%93.9%98.0%99.5%99.8%99.9%
nov 20170.0%0.1%3.0%14.6%37.3%64.8%84.2%93.9%98.0%99.4%99.7%99.8%
out 20170.0%0.1%3.0%14.6%37.3%64.8%84.1%93.8%98.0%99.4%99.7%99.8%
set 20170.0%0.1%3.0%14.6%37.3%64.9%84.2%93.9%98.1%99.5%99.8%99.9%
ago 20170.0%0.2%3.1%14.7%37.5%65.0%84.3%94.0%98.2%99.6%99.9%100.0%
jul 20170.0%0.2%3.1%14.7%37.5%65.0%84.3%94.0%98.2%99.6%99.9%100.0%
jun 20170.0%0.2%3.1%14.7%37.5%65.0%84.2%93.9%98.0%99.4%99.7%99.8%
mai 20170.0%0.2%3.1%14.8%37.6%65.1%84.3%94.0%98.1%99.5%99.8%99.9%
abr 20170.0%0.2%3.1%14.8%37.7%65.2%84.3%94.1%98.2%99.6%99.9%100.0%
mar 20170.0%0.2%3.2%14.9%37.9%65.3%84.4%94.2%98.3%99.7%100.0%100.0%
fev 20170.0%0.2%3.1%14.8%37.9%65.3%84.3%94.1%98.2%99.6%99.9%100.0%
jan 20170.0%0.2%3.2%14.9%38.0%65.4%84.4%94.1%98.2%99.6%99.9%100.0%
dez 20160.0%0.2%3.2%15.0%38.1%65.4%84.4%94.2%98.3%99.7%100.0%100.0%
nov 20160.0%0.2%3.2%15.0%38.0%65.3%84.3%94.0%98.1%99.5%99.8%99.9%
out 20160.0%0.2%3.2%15.0%38.0%65.3%84.3%94.1%98.2%99.6%99.9%100.0%
set 20160.0%0.2%3.2%15.0%38.1%65.4%84.4%94.1%98.2%99.6%99.9%100.0%
ago 20160.0%0.2%3.2%15.1%38.2%65.5%84.5%94.2%98.3%99.7%100.0%100.0%
jul 20160.0%0.2%3.2%15.0%38.1%65.4%84.3%94.1%98.2%99.6%99.9%100.0%
jun 20160.0%0.2%3.2%15.0%38.1%65.4%84.3%94.1%98.2%99.6%99.9%100.0%
mai 20160.0%0.2%3.2%15.0%38.2%65.5%84.4%94.2%98.3%99.7%100.0%100.0%
abr 20160.0%0.2%3.2%15.1%38.2%65.5%84.3%94.1%98.1%99.5%99.8%99.9%
mar 20160.0%0.2%3.2%15.1%38.3%65.6%84.5%94.2%98.3%99.7%100.0%100.0%
fev 20160.0%0.2%3.3%15.2%38.4%65.6%84.4%94.1%98.2%99.6%99.9%100.0%
jan 20160.0%0.2%3.3%15.2%38.5%65.7%84.4%94.1%98.2%99.6%99.9%100.0%
dez 20150.0%0.2%3.3%15.2%38.5%65.7%84.4%94.1%98.1%99.5%99.8%99.9%
nov 20150.0%0.2%3.3%15.3%38.6%65.8%84.5%94.2%98.2%99.6%99.9%100.0%
out 20150.0%0.2%3.3%15.3%38.7%65.9%84.6%94.3%98.3%99.7%100.0%100.0%
set 20150.0%0.2%3.3%15.3%38.7%65.9%84.6%94.2%98.2%99.6%99.9%100.0%
ago 20150.0%0.2%3.3%15.4%38.8%65.9%84.5%94.1%98.1%99.4%99.7%99.8%
jul 20150.0%0.2%3.4%15.5%39.0%66.1%84.7%94.3%98.3%99.6%99.9%99.9%
jun 20150.0%0.2%3.4%15.6%39.2%66.2%84.7%94.3%98.4%99.7%100.0%100.0%
mai 20150.0%0.2%3.4%15.6%39.2%66.1%84.6%94.2%98.3%99.6%99.9%99.9%
abr 20150.0%0.2%3.4%15.7%39.3%66.2%84.7%94.3%98.4%99.7%100.0%100.0%
mar 20150.0%0.2%3.4%15.7%39.3%66.2%84.7%94.3%98.4%99.7%100.0%100.0%
fev 20150.0%0.2%3.4%15.8%39.5%66.3%84.7%94.2%98.3%99.6%99.9%99.9%
jan 20150.0%0.2%3.4%15.8%39.6%66.4%84.7%94.2%98.3%99.6%99.9%99.9%
dez 20140.0%0.2%3.4%15.8%39.6%66.4%84.7%94.2%98.3%99.6%99.9%99.9%
nov 20140.0%0.2%3.4%15.8%39.6%66.4%84.7%94.2%98.3%99.6%99.9%99.9%
out 20140.0%0.2%3.4%15.8%39.6%66.4%84.7%94.2%98.3%99.6%99.9%99.9%
set 20140.0%0.2%3.5%16.0%39.8%66.6%84.9%94.4%98.5%99.8%100.0%100.0%
ago 20140.0%0.2%3.5%16.0%39.9%66.7%84.8%94.3%98.3%99.6%99.9%99.9%
jul 20140.0%0.2%3.5%16.1%40.0%66.8%84.9%94.4%98.5%99.8%100.0%100.0%
jun 20140.0%0.2%3.5%16.1%40.1%66.9%84.9%94.3%98.4%99.7%100.0%100.0%
mai 20140.0%0.2%3.5%16.1%40.2%66.8%84.8%94.2%98.3%99.6%99.9%99.9%
abr 20140.0%0.2%3.5%16.2%40.3%66.9%84.8%94.2%98.3%99.6%99.9%99.9%
mar 20140.0%0.2%3.6%16.4%40.6%67.0%84.9%94.3%98.4%99.7%100.0%100.0%
fev 20140.0%0.2%3.6%16.5%40.7%67.1%84.9%94.3%98.4%99.7%100.0%100.0%
jan 20140.0%0.2%3.6%16.5%40.8%67.1%84.9%94.2%98.3%99.6%99.9%99.9%
dez 20130.0%0.2%3.6%16.7%41.0%67.1%84.9%94.2%98.3%99.6%99.9%99.9%
nov 20130.0%0.2%3.6%16.7%41.0%67.0%84.8%94.1%98.2%99.5%99.8%99.8%
out 20130.0%0.2%3.7%16.8%41.1%67.0%84.8%94.2%98.3%99.6%99.9%99.9%
set 20130.0%0.2%3.7%16.8%41.1%66.9%84.7%94.1%98.3%99.6%99.9%99.9%
ago 20130.0%0.3%3.8%17.0%41.4%67.1%84.8%94.2%98.4%99.7%100.0%100.0%
jul 20130.0%0.3%3.8%17.0%41.4%67.1%84.8%94.1%98.3%99.6%99.9%99.9%
jun 20130.0%0.3%3.8%16.9%41.3%66.9%84.7%94.1%98.3%99.7%100.0%100.0%
mai 20130.0%0.3%3.9%17.0%41.4%66.8%84.6%94.0%98.3%99.7%100.0%100.0%
abr 20130.0%0.3%3.9%17.2%41.5%66.7%84.5%93.9%98.2%99.5%99.8%99.9%
mar 20130.0%0.3%4.1%17.5%41.8%66.8%84.6%94.1%98.4%99.7%100.0%100.0%
fev 20130.0%0.3%4.1%17.7%41.9%66.7%84.5%94.0%98.3%99.6%99.9%100.0%
jan 20130.0%0.3%4.1%17.8%42.0%66.6%84.5%94.0%98.3%99.6%99.9%100.0%
dez 20120.0%0.3%4.2%17.9%41.9%66.3%84.3%93.9%98.2%99.5%99.8%99.9%
nov 20120.0%0.3%4.2%17.9%41.8%66.2%84.2%93.8%98.1%99.5%99.8%99.9%
out 20120.0%0.3%4.2%17.9%41.8%66.1%84.2%93.9%98.2%99.6%99.9%99.9%
set 20120.0%0.3%4.3%18.2%42.0%66.2%84.2%93.9%98.3%99.7%100.0%100.0%
ago 20120.0%0.3%4.3%18.3%42.1%66.1%84.1%93.9%98.2%99.6%99.9%99.9%
jul 20120.0%0.3%4.3%18.3%42.0%66.1%84.1%93.9%98.2%99.6%99.9%99.9%
jun 20120.0%0.3%4.2%18.2%41.8%65.9%84.0%93.8%98.2%99.6%99.9%99.9%
mai 20120.0%0.3%4.3%18.3%41.8%65.8%84.0%93.9%98.3%99.7%100.0%100.0%
abr 20120.0%0.3%4.3%18.4%41.9%65.7%83.9%93.8%98.2%99.6%99.9%99.9%
mar 20120.0%0.3%4.4%18.5%41.8%65.5%83.8%93.7%98.2%99.6%99.9%99.9%
fev 20120.0%0.3%4.4%18.4%41.6%65.3%83.7%93.7%98.2%99.6%99.9%99.9%
jan 20120.0%0.3%4.4%18.3%41.5%65.2%83.7%93.8%98.3%99.6%99.9%99.9%
dez 20110.0%0.3%4.6%18.3%41.3%65.1%83.5%93.7%98.2%99.5%99.8%99.8%
nov 20110.0%0.3%4.5%18.1%41.1%64.9%83.5%93.7%98.2%99.5%99.8%99.8%
out 20110.0%0.3%4.5%18.1%41.1%64.7%83.3%93.6%98.1%99.5%99.8%99.8%
set 20110.0%0.3%4.3%17.7%40.7%64.4%83.2%93.6%98.1%99.5%99.8%99.8%
ago 20110.0%0.3%4.3%17.8%40.8%64.5%83.4%93.8%98.4%99.8%100.0%100.0%
jul 20110.0%0.3%4.1%17.3%40.3%64.2%83.2%93.7%98.2%99.6%99.9%99.9%
jun 20110.0%0.3%4.0%17.0%40.1%64.0%83.1%93.6%98.1%99.5%99.8%99.8%
mai 20110.0%0.3%4.1%17.1%40.1%64.1%83.3%93.8%98.3%99.7%100.0%100.0%
abr 20110.0%0.3%4.1%16.9%40.0%64.0%83.2%93.7%98.2%99.6%99.9%99.9%
mar 20110.0%0.3%4.1%16.9%40.1%64.0%83.1%93.6%98.2%99.6%99.9%99.9%
fev 20110.0%0.3%4.0%16.8%40.0%63.9%83.0%93.6%98.1%99.5%99.8%99.8%
jan 20110.0%0.3%4.0%16.9%40.1%64.0%83.2%93.8%98.3%99.7%100.0%100.0%
dez 20100.0%0.3%4.1%17.0%40.1%64.0%83.1%93.7%98.2%99.6%99.9%99.9%
nov 20100.0%0.3%4.1%17.0%40.1%64.0%83.2%93.8%98.3%99.7%100.0%100.0%
out 20100.0%0.3%4.1%17.1%40.2%64.2%83.3%93.8%98.3%99.7%100.0%100.0%
set 20100.0%0.3%4.1%17.2%40.4%64.3%83.3%93.9%98.4%99.8%100.0%100.0%
ago 20100.0%0.3%4.0%17.1%40.2%64.1%83.1%93.8%98.2%99.5%99.8%99.8%
jul 20100.0%0.3%4.1%17.2%40.4%64.2%83.3%94.0%98.4%99.8%100.0%100.0%
jun 20100.0%0.3%4.0%17.2%40.4%64.3%83.3%93.9%98.3%99.6%99.9%99.9%
mai 20100.0%0.3%4.1%17.2%40.5%64.5%83.4%94.0%98.3%99.6%99.9%99.9%
abr 20100.0%0.3%4.0%17.2%40.6%64.6%83.5%94.0%98.3%99.6%99.8%99.8%
mar 20100.0%0.3%4.0%17.2%40.6%64.7%83.5%94.0%98.3%99.6%99.8%99.8%
fev 20100.0%0.3%3.8%17.1%40.6%64.8%83.6%94.1%98.4%99.7%99.9%99.9%
jan 20100.0%0.3%3.8%17.2%40.8%65.0%83.8%94.3%98.5%99.8%100.0%100.0%
dez 20090.0%0.3%3.8%17.1%40.8%65.0%83.8%94.3%98.5%99.8%100.0%100.0%
nov 20090.0%0.3%3.9%17.2%40.9%65.0%83.8%94.2%98.3%99.6%99.8%99.8%
out 20090.0%0.3%3.9%17.3%41.1%65.3%84.1%94.4%98.5%99.8%100.0%100.0%
set 20090.0%0.3%3.9%17.3%41.2%65.4%84.2%94.5%98.6%99.8%100.0%100.0%
ago 20090.0%0.3%3.9%17.2%41.1%65.3%84.1%94.3%98.4%99.6%99.8%99.8%
jul 20090.0%0.3%3.9%17.2%41.2%65.5%84.3%94.5%98.6%99.8%100.0%100.0%
jun 20090.0%0.3%3.9%17.3%41.5%65.7%84.5%94.6%98.8%100.0%100.0%100.0%
mai 20090.0%0.2%3.9%17.3%41.5%65.8%84.5%94.4%98.5%99.6%99.8%99.8%
abr 20090.0%0.3%4.0%17.6%41.7%66.0%84.7%94.7%98.8%99.9%100.0%100.0%
mar 20090.0%0.3%4.0%17.5%41.7%65.8%84.5%94.5%98.6%99.7%99.9%99.9%
fev 20090.0%0.3%4.1%17.6%41.9%65.9%84.5%94.5%98.7%99.8%100.0%100.0%
jan 20090.0%0.3%4.1%17.6%42.0%66.1%84.6%94.5%98.7%99.8%100.0%100.0%
dez 20080.0%0.3%4.1%17.5%41.8%66.0%84.5%94.5%98.7%99.8%100.0%100.0%
nov 20080.0%0.3%4.2%17.8%41.9%66.2%84.7%94.6%98.4%99.5%99.9%99.9%
out 20080.0%0.2%4.1%17.4%41.5%65.9%84.5%94.4%98.3%99.4%99.8%99.8%
set 20080.0%0.2%4.0%17.4%41.5%66.0%84.6%94.5%98.4%99.5%99.9%99.9%
ago 20080.0%0.2%4.1%17.6%41.6%66.4%85.0%94.7%98.6%99.7%100.0%100.0%
jul 20080.0%0.2%3.9%16.9%41.1%66.0%84.7%94.6%98.4%99.5%99.9%99.9%
jun 20080.0%0.2%4.0%17.0%41.4%66.1%84.8%94.6%98.4%99.5%99.9%99.9%
mai 20080.0%0.2%4.1%17.4%41.7%66.2%85.1%94.8%98.5%99.6%100.0%100.0%
abr 20080.0%0.2%4.0%17.3%41.7%66.1%85.0%94.6%98.3%99.5%99.8%99.8%
mar 20080.0%0.2%4.1%17.5%41.8%66.3%85.3%94.8%98.5%99.6%99.9%99.9%
fev 20080.0%0.3%4.0%17.3%41.6%66.2%85.3%94.8%98.5%99.6%100.0%100.0%
jan 20080.0%0.3%4.0%17.3%41.4%66.2%85.3%94.8%98.5%99.6%100.0%100.0%
dez 20070.0%0.2%3.9%17.3%41.3%66.0%85.2%94.7%98.4%99.5%99.9%99.9%
nov 20070.0%0.2%4.0%17.3%41.4%66.1%85.3%94.8%98.6%99.7%100.0%100.0%
out 20070.0%0.3%4.0%16.9%41.2%66.0%85.1%94.7%98.5%99.6%100.0%100.0%
set 20070.0%0.2%3.9%16.9%41.2%66.0%85.2%94.8%98.5%99.6%99.9%99.9%
ago 20070.0%0.3%3.9%17.0%41.3%66.0%85.3%94.9%98.5%99.6%100.0%100.0%
jul 20070.0%0.2%3.9%17.2%41.6%66.2%85.3%94.9%98.4%99.4%99.7%99.7%
jun 20070.0%0.3%4.1%17.4%41.8%66.4%85.6%95.2%98.7%99.8%100.0%100.0%
mai 20070.0%0.3%4.2%17.2%41.3%66.3%85.4%95.0%98.6%99.6%99.9%99.9%
abr 20070.0%0.3%4.3%17.5%41.3%66.6%85.5%95.0%98.7%99.7%100.0%100.0%
mar 20070.0%0.4%4.3%17.5%41.3%66.8%85.5%95.0%98.6%99.6%99.9%99.9%
fev 20070.1%0.5%4.5%17.7%41.7%67.2%86.1%95.3%98.9%99.9%100.0%100.0%
jan 20070.1%0.5%4.5%17.9%42.0%67.4%86.0%95.1%98.6%99.7%100.0%100.0%
dez 20060.1%0.6%4.8%18.5%42.5%67.8%86.4%95.3%98.8%99.8%100.0%100.0%
nov 20060.1%0.6%5.1%19.1%43.2%68.5%86.9%95.4%98.9%99.9%100.0%100.0%
out 20060.1%0.6%5.1%19.1%43.4%68.5%86.7%95.2%98.7%99.7%100.0%100.0%
set 20060.1%0.6%4.9%18.6%42.8%68.4%86.9%95.3%98.8%99.8%100.0%100.0%
ago 20060.1%0.5%4.6%18.2%42.5%68.3%86.8%95.2%98.7%99.7%100.0%100.0%
jul 20060.1%0.4%4.1%17.2%41.8%68.0%86.7%95.4%98.8%99.8%100.0%100.0%
jun 20060.1%0.4%4.0%16.3%41.2%67.3%86.3%95.2%98.6%99.7%99.9%99.9%
mai 20060.1%0.4%4.1%15.6%40.6%67.1%86.1%95.1%98.6%99.8%100.0%100.0%
abr 20060.1%0.5%4.2%15.9%41.0%67.9%86.8%95.4%98.5%99.7%99.9%99.9%
mar 20060.1%0.7%4.4%16.2%40.9%68.1%86.9%95.6%98.9%99.9%100.0%100.0%
fev 20060.2%0.9%4.5%16.9%40.9%68.4%87.0%95.3%98.6%99.7%99.9%99.9%
jan 20060.2%0.6%4.2%16.3%40.3%68.5%87.0%95.3%98.7%99.7%99.9%99.9%
dez 20050.2%0.6%4.3%17.0%42.3%70.6%88.0%95.8%98.9%99.9%100.0%100.0%
nov 20050.1%0.6%4.5%17.7%43.5%71.1%88.0%95.6%98.7%99.7%99.9%99.9%
out 20050.2%0.6%4.2%18.3%45.9%72.2%87.9%95.6%98.8%99.7%100.0%100.0%
set 20050.1%0.6%5.1%19.3%46.4%71.7%87.3%95.5%98.9%99.7%100.0%100.0%
ago 20050.0%1.0%5.6%20.6%45.7%71.2%87.7%95.6%98.5%99.4%99.9%99.9%
jul 20050.0%0.0%0.0%10.0%40.0%60.0%80.0%90.0%90.0%100.0%100.0%100.0%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
set 202235 k7,1 k2,5 k16 k4821,3 k162,0 k159    594 165019,8 k13173,9 k44 
set 202235 k7,1 k2,5 k16 k4821,3 k162,0 k159    594 139814,4 k1231,1 k16 
ago 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    58994%165019,7 k13173,9 k44 
jul 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    58694%138214,3 k1231,1 k16 
jun 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    58594%164819,5 k13173,8 k44 
mai 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    58094% 37814,3 k1231,1 k16 
abr 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    57994%164819,5 k13153,8 k44 
mar 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    57794% 37214,2 k1231,0 k16 
fev 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    57594%164819,4 k13123,8 k44 
jan 202235 k7,0 k2,5 k16 k4821,3 k162,0 k159    57594% 37014,1 k1231,0 k16 
dez 202135 k7,0 k2,5 k16 k4821,3 k162,0 k159    57194%164819,4 k13123,8 k42 
nov 202135 k7,0 k2,5 k16 k4821,3 k162,0 k159    57094% 36614,0 k12395216 
out 202135 k6,9 k2,5 k16 k4821,3 k162,0 k159    56994%164819,4 k13123,8 k42 
set 202135 k6,9 k2,5 k16 k4821,3 k162,0 k159    56994% 36613,9 k12392216 
ago 202135 k6,9 k2,5 k15 k4821,3 k162,0 k159    56694%164819,4 k13123,7 k42 
jul 202135 k6,9 k2,5 k15 k4821,3 k162,0 k159    56494% 36013,9 k12388016 
jun 202135 k6,9 k2,5 k15 k4821,3 k162,0 k159    56394%164419,3 k13103,7 k42 
mai 202135 k6,9 k2,5 k15 k4821,3 k162,0 k159    56294% 35213,8 k12384916 
abr 202135 k6,9 k2,5 k15 k4821,3 k162,0 k159    56094%164419,3 k13103,6 k38 
mar 202135 k6,9 k2,5 k15 k4821,3 k162,0 k159    55794% 34513,7 k12383716 
fev 202135 k6,8 k2,5 k15 k4821,3 k162,0 k159    55694%164119,2 k13103,6 k37 
jan 202135 k6,8 k2,5 k15 k4821,3 k162,0 k159    55394% 34113,6 k12182115 
dez 202035 k6,8 k2,5 k15 k4821,3 k162,0 k159    55094%164119,2 k13103,6 k37 
nov 202034 k6,8 k2,5 k15 k4821,3 k162,0 k159    54894% 33813,6 k12180715 
out 202034 k6,8 k2,5 k15 k4821,3 k162,0 k159    54794%164019,2 k13103,6 k36 
set 202034 k6,8 k2,5 k15 k4821,3 k162,0 k159    54694% 33413,5 k12178114 
ago 202034 k6,8 k2,5 k15 k4821,3 k162,0 k159    54494%164019,2 k13103,5 k36 
jul 202034 k6,8 k2,5 k15 k4821,3 k162,0 k159    54194% 33113,4 k12176310 
jun 202034 k6,8 k2,5 k15 k4821,3 k162,0 k159    53994%163819,1 k13103,5 k35 
mai 202034 k6,7 k2,5 k15 k4821,3 k161,9 k159    53694% 32813,3 k1217489 
abr 202034 k6,7 k2,5 k15 k4821,3 k161,9 k159    52994%163719,1 k13103,5 k34 
mar 202034 k6,7 k2,5 k15 k4821,3 k161,9 k159    52894% 32413,3 k1217299 
fev 202034 k6,7 k2,5 k15 k4821,3 k161,9 k159    52294%163719,1 k13103,5 k34 
jan 202034 k6,7 k2,5 k14 k4821,3 k161,9 k159    51994% 32013,2 k1217146 
dez 201934 k6,7 k2,5 k14 k4821,3 k161,9 k159    51794%163319,1 k1393,5 k34 
nov 201934 k6,6 k2,5 k14 k4821,3 k161,9 k159    51694% 31613,1 k1217016 
out 201934 k6,6 k2,5 k14 k4821,2 k161,9 k159    51594%163219,1 k1393,5 k34 
set 201934 k6,6 k2,5 k14 k4821,2 k161,9 k159    51194% 30913,1 k 116885 
ago 201934 k6,6 k2,5 k14 k4821,2 k161,9 k159    50994%163219,0 k1383,5 k34 
jul 201934 k6,6 k2,5 k14 k4811,2 k161,9 k159    50694% 30313,0 k 116795 
jun 201934 k6,6 k2,5 k14 k4811,2 k161,9 k159    50594%163219,0 k1383,5 k34 
mai 201934 k6,6 k2,5 k14 k4801,2 k161,9 k159    50294% 29612,9 k 116595 
abr 201933 k6,6 k2,5 k14 k4801,2 k161,9 k159    50294%163119,0 k1383,4 k34 
mar 201933 k6,5 k2,5 k14 k4801,2 k161,9 k159    50294% 28912,8 k 116455 
fev 201933 k6,5 k2,5 k14 k4801,2 k161,9 k159    50194%163118,9 k1383,4 k34 
jan 201933 k6,5 k2,4 k13 k4801,1 k161,9 k159    50194% 28812,8 k 116345 
dez 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49794%162918,9 k1383,4 k32 
nov 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49794% 28412,7 k 116195 
out 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49694%162918,9 k1383,4 k32 
set 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49694% 28012,7 k 116105 
ago 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49594%162918,8 k1383,4 k32 
jul 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49494% 27512,6 k 116045 
jun 201833 k6,5 k2,4 k13 k4801,1 k161,9 k159    49094%162918,8 k1383,3 k32 
mai 201833 k6,4 k2,3 k13 k4801,1 k161,9 k159    48894% 26812,4 k 115834 
abr 201833 k6,4 k2,3 k13 k4801,1 k161,9 k159    48694%162918,8 k1383,3 k32 
mar 201833 k6,4 k2,3 k13 k4801,1 k161,9 k159    48494% 26412,4 k 115664 
fev 201832 k6,4 k2,3 k13 k4801,1 k161,9 k159    47794%162918,7 k1383,3 k32 
jan 201832 k6,4 k2,3 k13 k4801,1 k161,9 k159    47794% 25012,3 k 115534 
dez 201732 k6,4 k2,3 k13 k4801,1 k161,9 k159    47694%162918,7 k1383,3 k32 
nov 201732 k6,4 k2,3 k13 k4801,1 k161,9 k159    47494% 23912,2 k 115404 
out 201732 k6,4 k2,3 k13 k4801,1 k161,9 k159    47294%162918,7 k1383,2 k32 
set 201732 k6,3 k2,2 k13 k4801,1 k161,9 k159    47294% 23012,1 k 115284 
ago 201732 k6,3 k2,2 k13 k4801,1 k161,9 k159    46894%162718,7 k1383,2 k32 
jul 201732 k6,3 k2,2 k13 k4801,1 k161,9 k159    46594% 22311,9 k 1 5164 
jun 201732 k6,3 k2,2 k13 k4801,1 k161,9 k159    46494%162518,6 k1383,2 k32 
mai 201732 k6,3 k2,2 k13 k4801,1 k161,9 k159    46394% 21411,8 k 1 4904 
abr 201732 k6,3 k2,2 k12 k4801,1 k161,9 k159    46094%162518,6 k1383,1 k31 
mar 201732 k6,2 k2,2 k12 k4801,1 k161,8 k159    45994% 20111,7 k 1 4784 
fev 201731 k6,2 k2,2 k12 k4801,1 k161,8 k159    45794%162518,5 k1383,1 k30 
jan 201731 k6,2 k2,1 k12 k4801,1 k161,8 k159    45394% 19411,6 k 1 4603 
dez 201631 k6,2 k2,1 k12 k4801,1 k161,8 k159    44994%162518,5 k1383,1 k30 
nov 201631 k6,2 k2,1 k12 k4801,1 k161,8 k159    44994% 17511,4 k 1 4331 
out 201631 k6,1 k2,1 k12 k4801,1 k161,8 k159    44894%162518,5 k1383,1 k30 
set 201631 k6,1 k2,1 k12 k4801,1 k161,8 k159    44894% 16111,4 k 1 403  
ago 201631 k6,1 k2,1 k12 k4801,1 k161,8 k159    44894%162518,4 k1383,0 k30 
jul 201631 k6,1 k2,1 k12 k4801,1 k161,8 k159    44694% 14211,2 k   361  
jun 201631 k6,1 k2,0 k12 k4801,1 k161,8 k159    44594%162418,4 k1383,0 k30 
mai 201631 k6,1 k2,0 k12 k4801,1 k161,8 k159    44394% 13711,1 k   347  
abr 201631 k6,1 k2,0 k12 k4801,1 k161,8 k159    43994%162418,4 k1383,0 k29 
mar 201631 k6,1 k2,0 k12 k4801,1 k161,8 k159    43894% 1251971   325  
fev 201631 k6,0 k2,0 k12 k4801,1 k161,8 k159    43694%162418,4 k1383,0 k29 
jan 201630 k6,0 k2,0 k12 k4801,1 k161,8 k159    43395% 1131880   320  
dez 201530 k6,0 k2,0 k12 k4801,1 k161,8 k159    43095%162418,4 k1383,0 k29 
nov 201530 k6,0 k2,0 k12 k4801,1 k161,8 k159    42995% 1081788   281  
out 201530 k6,0 k1,9 k11 k4801,1 k161,8 k159    42895%162318,3 k1383,0 k29 
set 201530 k6,0 k1,9 k11 k4801,1 k161,8 k159    42595% 971683   256  
ago 201530 k5,9 k1,9 k11 k4801,1 k161,8 k159    42395%161918,3 k1382,9 k29 
jul 201530 k5,9 k1,9 k11 k4801,1 k161,8 k159    42395% 841507   237  
jun 201530 k5,9 k1,9 k11 k4801,1 k161,8 k159    42195%161818,3 k1382,9 k29 
mai 201530 k5,9 k1,9 k11 k4801,1 k161,8 k159    42195% 811424   228  
abr 201530 k5,9 k1,9 k11 k4801,1 k161,8 k159    42095%161818,2 k1382,9 k29 
mar 201530 k5,8 k1,8 k11 k4791,1 k161,8 k159    41795% 711372   213  
fev 201530 k5,8 k1,8 k11 k4791,1 k151,8 k159    41595%161818,2 k1382,8 k29 
jan 201529 k5,8 k1,8 k11 k4791,1 k151,8 k159    41595% 681323   203  
dez 201429 k5,8 k1,8 k11 k4791,1 k141,8 k159    41295%161718,2 k1382,8 k29 
nov 201429 k5,8 k1,8 k11 k4791,1 k141,8 k159    41095% 611293   166  
out 201429 k5,8 k1,8 k11 k4791,1 k141,8 k159    40995%160818,1 k1382,8 k28 
set 201429 k5,7 k1,8 k11 k4791,1 k141,8 k159    40895% 561257   147  
ago 201429 k5,7 k1,8 k11 k4791,1 k141,8 k159    40795%160718,1 k1382,8 k28 
jul 201429 k5,7 k1,7 k11 k4791,1 k141,8 k159    40795% 531227   131  
jun 201429 k5,7 k1,7 k10 k4781,1 k141,8 k159    40495%160718,1 k1382,8 k28 
mai 201429 k5,6 k1,7 k10 k4731,0 k141,8 k159    40495% 481179   115  
abr 201429 k5,6 k1,7 k10 k4731,0 k141,8 k159    40295%160518,1 k1382,7 k28 
mar 201429 k5,6 k1,7 k10 k4731,0 k141,8 k159    39695% 381137   96  
fev 201428 k5,5 k1,7 k10 k4731,0 k141,8 k159    39495%160518,0 k1382,7 k28 
jan 201428 k5,5 k1,7 k10 k4731,0 k141,8 k159    39195% 24193   80  
dez 201328 k5,5 k1,6 k10,0 k4731,0 k141,8 k159    38895%160318,0 k1382,7 k28 
nov 201328 k5,5 k1,6 k9,9 k4731,0 k141,8 k159    38495%  11   4  
out 201328 k5,4 k1,6 k9,9 k4731,0 k141,8 k159    38395%160218,0 k1382,7 k28 
set 201328 k5,4 k1,6 k9,8 k4731,0 k141,7 k159    38095%  1    2  
ago 201327 k5,4 k1,6 k9,6 k4731,0 k141,7 k159    37695%160017,9 k1382,6 k28 
jul 201327 k5,4 k1,6 k9,6 k4721,0 k141,7 k159    37095%  1    2  
jun 201327 k5,3 k1,6 k9,5 k4721,0 k141,7 k159    36795%159917,9 k1382,6 k27 
mai 201327 k5,3 k1,5 k9,3 k472998141,7 k159    36396%  1    2  
abr 201326 k5,3 k1,5 k9,2 k472989141,7 k159    35896%159817,8 k1382,6 k27 
mar 201326 k5,2 k1,5 k9,2 k472988141,7 k159    35696%  1    2  
fev 201326 k5,2 k1,5 k9,1 k472988141,7 k159    35396%159717,8 k1382,6 k26 
jan 201326 k5,2 k1,5 k9,0 k472983141,7 k159    34896%  1    2  
dez 201226 k5,2 k1,5 k9,0 k472975141,7 k159    34596%159517,8 k1382,6 k26 
nov 201225 k5,1 k1,5 k8,9 k472970141,7 k159    34396%  1    2  
out 201225 k5,1 k1,5 k8,9 k472968141,7 k159    34196%159417,8 k1382,6 k26 
set 201225 k5,1 k1,4 k8,8 k472967141,7 k159    33696%  1    2  
ago 201225 k5,1 k1,4 k8,7 k472964141,7 k159    33496%159217,7 k1382,5 k26 
jul 201224 k5,0 k1,4 k8,6 k472960141,7 k159    32996%  1    2  
jun 201224 k5,0 k1,4 k8,5 k472954141,7 k159    32896%159017,6 k1382,5 k25 
mai 201224 k5,0 k1,4 k8,5 k471952141,7 k159    32396%158817,6 k1382,5 k25 
abr 201224 k4,9 k1,4 k8,4 k469951141,7 k159    32196%158617,6 k1382,5 k23 
mar 201224 k4,9 k1,4 k8,3 k469949141,6 k159    31896%158517,5 k1342,5 k23 
fev 201223 k4,9 k1,3 k8,3 k466945141,6 k159    31796%158417,4 k1342,4 k23 
jan 201223 k4,8 k1,3 k8,2 k466941141,6 k159    31796%158017,3 k1342,4 k22 
dez 201123 k4,8 k1,3 k8,1 k465940141,6 k159    31396%157917,3 k1342,4 k22 
nov 201123 k4,8 k1,3 k8,0 k463938141,6 k159    30996%157417,2 k1342,4 k22 
out 201122 k4,7 k1,3 k7,9 k463935141,6 k159    30896%157417,2 k1342,4 k22 
set 201122 k4,7 k1,3 k7,8 k463931141,6 k159    30796%157017,1 k1342,4 k22 
ago 201122 k4,7 k1,3 k7,7 k463929141,6 k159    30596%156617,0 k1342,3 k22 
jul 201122 k4,6 k1,3 k7,6 k463925141,6 k159    30196%156617,0 k1342,3 k22 
jun 201121 k4,6 k1,2 k7,5 k463915141,5 k159    29596%156517,0 k1342,3 k22 
mai 201121 k4,5 k1,2 k7,3 k463904141,5 k159    29195%156016,9 k1342,3 k22 
abr 201121 k4,5 k1,2 k7,2 k419868141,5 k159    28696%155816,8 k1342,3 k22 
mar 201121 k4,4 k1,2 k7,1 k419862141,5 k159    28396%155516,7 k1342,2 k22 
fev 201120 k4,4 k1,2 k7,0 k413856141,5 k159    28396%155416,7 k1342,2 k22 
jan 201120 k4,4 k1,2 k7,0 k413855141,5 k159    27696%154816,6 k1342,2 k22 
dez 201020 k4,3 k1,1 k6,9 k413850141,4 k159    27496%154116,5 k1342,1 k22 
nov 201020 k4,3 k1,1 k6,8 k413850141,4 k159    27496%154016,5 k1342,1 k22 
out 201020 k4,2 k1,1 k6,8 k413849141,4 k159    27296%154016,5 k1342,1 k22 
set 201020 k4,2 k1,1 k6,7 k413849141,4 k159    26796%152616,4 k1342,1 k22 
ago 201020 k4,2 k1,1 k6,7 k413846141,4 k159    26496%152316,4 k1332,0 k22 
jul 201020 k4,1 k1,1 k6,6 k413843131,4 k159    26096%152316,4 k1332,0 k22 
jun 201019 k4,1 k1,0 k6,5 k413837131,4 k159    25996%1662111 k13284,4 k458
mai 201019 k4,1 k1,0 k6,5 k413832131,4 k159    25596%152116,3 k1332,0 k22 
abr 201019 k4,0 k1,0 k6,4 k413823131,4 k159    25296%1662111 k13284,4 k458
mar 201019 k4,0 k9996,2 k413819131,4 k159    24996%151516,2 k1332,0 k22 
fev 201019 k4,0 k9836,1 k413811131,4 k159    24696%1661111 k13284,4 k458
jan 201019 k3,9 k9696,1 k413801131,4 k159    24496%151116,2 k1332,0 k21 
dez 200919 k3,9 k9536,0 k412788131,4 k159    24496%1660111 k13284,4 k457
nov 200918 k3,9 k9415,8 k412786131,4 k159    24296%150916,1 k1331,9 k21 
out 200918 k3,8 k9265,7 k408784131,4 k158    24096%1660111 k13284,4 k457
set 200918 k3,8 k9115,6 k356779131,4 k155    23696%150616,1 k1231,9 k21 
ago 200918 k3,8 k8965,5 k353772131,3 k154    23296%1660111 k13284,4 k447
jul 200918 k3,7 k8795,3 k350763131,3 k150    22996%150516,0 k1231,9 k21 
jun 200918 k3,6 k8675,3 k350760131,3 k150    22396%1660111 k13274,4 k443
mai 200917 k3,6 k8515,1 k349755131,3 k145    21396%150116,0 k1231,9 k21 
abr 200917 k3,5 k8385,0 k348750131,3 k140    20996%1660111 k13274,3 k443
mar 200917 k3,4 k8244,9 k348739131,3 k138    20396%149615,9 k1231,9 k21 
fev 200917 k3,3 k8064,8 k346723131,3 k135    19796%1660111 k13274,3 k443
jan 200917 k3,3 k7944,7 k346706131,3 k132    19096%149315,9 k1231,8 k19 
dez 200816 k3,2 k7764,6 k346699121,3 k132    18296%1660111 k13274,3 k442
nov 200816 k3,0 k7604,5 k346672121,2 k130    17696%149015,9 k1231,8 k19 
out 200816 k3,0 k7474,4 k346667121,2 k130    17596%1660110 k13274,3 k44 
set 200815 k2,9 k7344,3 k345664121,2 k129    17396%148815,8 k1231,8 k19 
ago 200815 k2,8 k7194,2 k345658121,2 k129    16696%1660110 k13274,3 k44 
jul 200815 k2,8 k7064,2 k344647121,2 k127    16096%148515,7 k1231,8 k19 
jun 200815 k2,7 k6934,1 k343637121,2 k123    16096%1660110 k13274,3 k44 
mai 200814 k2,6 k6814,0 k342631121,2 k120    15596%148015,7 k1231,7 k19 
abr 200814 k2,5 k6733,9 k342625121,1 k116    15096%1660110 k13274,3 k44 
mar 200814 k2,4 k6643,8 k341618121,1 k114    14796%147615,6 k1231,7 k18 
fev 200814 k2,3 k6533,7 k337615121,1 k109    14096%1660110 k13214,3 k44 
jan 200813 k2,2 k6433,6 k337614121,1 k106    13796%147415,5 k1231,6 k18 
dez 200713 k2,2 k6293,6 k337612121,1 k100    13396%1659110 k13214,3 k44 
nov 200713 k2,1 k6163,5 k337603121,1 k96    13096%147115,5 k1231,6 k18 
out 200712 k2,1 k6033,3 k334597121,1 k91    12596%1658110 k13214,3 k44 
set 200712 k2,0 k5883,2 k334592121,0 k88    12096%146815,4 k1231,6 k18 
ago 200712 k1,9 k5753,1 k334585121,0 k81    11396%1658110 k13214,3 k44 
jul 200712 k1,9 k5583,0 k331575121,0 k77    10996%144815,3 k1231,5 k18 
jun 200711 k1,8 k5392,8 k3315701299564    10496%1658110 k13214,2 k44 
mai 200711 k1,7 k5212,7 k3315571298256    9996%144515,2 k1231,5 k18 
abr 200710 k1,6 k5082,5 k3315461196746    9496%1658110 k13214,2 k44 
mar 200710,0 k1,5 k4832,4 k3315281192835    9296%144515,1 k1231,5 k18 
fev 20079,7 k1,4 k4702,3 k3295151190311    8696%1658110 k13214,2 k44 
jan 20079,3 k1,3 k4532,1 k3284979881     7496%144415,1 k1231,4 k18 
dez 20069,0 k1,2 k4291,9 k3284869851     6496%1658110 k13214,2 k44 
nov 20068,6 k1,1 k4161,7 k3284719822     5896%144315,1 k1231,4 k18 
out 20068,2 k1,0 k4001,6 k3194649812     4696%1658110 k13214,2 k44 
set 20067,6 k9063771,4 k3194369780     3296%144015,0 k1231,4 k18 
ago 20067,1 k8253581,3 k3174249723     2596%1656110 k13214,1 k44 
jul 20066,7 k7453391,2 k3173679661     996%143915,0 k1231,4 k18 
jun 20066,1 k6422971,0 k3173339584     797%1656110 k13214,1 k44 
mai 20065,5 k5662748293172918559      97%143815,0 k1231,4 k18 
abr 20065,2 k4842617343162557497      97%1656110 k13214,1 k44 
mar 20064,8 k4212436573132057434      97%143614,9 k1231,4 k18 
fev 20064,4 k3552305953131777391      97%1655110 k13214,1 k44 
jan 20064,1 k3212185213131337378      97%143414,9 k1231,4 k18 
dez 20053,8 k280191461274967370      97%1653110 k13214,0 k44 
nov 20053,4 k241164412273934318      97%143114,8 k1231,3 k18 
out 20052,9 k19615034322873170      97%1653110 k13214,0 k44 
set 20052,3 k16912927220772132      96%143014,8 k1231,3 k18 
ago 20051,5 k1155319814712115      97%1653110 k13214,0 k44 
jul 20052135642212      60%142714,7 k1231,3 k17 


50 most edited articles (> 25 edits)  More..

267793%480132User talk:GreenReaper154.7 Mb  
253894%245118Template:Upcoming events14.8 Mb  
164292%32091User talk:Spirou21.3 Mb  
147174%233210List of in-person furry conventions by attendance28.2 Mb  
112276%160181Category:People/People to add7.6 Mb  
85391%7049Template:Timeline of conventions31.5 Mb  
79386%11981List of furry LiveJournal communities21.4 Mb  
77591%21355User talk:Higgs Raccoon11.1 Mb  
63955%80172Babyfur15.5 Mb  
63458%103174Furry3.7 Mb  
63170%93137Fur Affinity7.7 Mb  
61774%109117Category:Comics2.4 Mb  
56183%7128Timeline of media coverage27.3 Mb  
50773%8397Encyclopædia Dramatica2.9 Mb  
48751%47198High Tail Hall5.1 Mb  
47873%6987Category:People1.8 Mb  
46483%6741Evil Sibe6.8 Mb  
45270%8882Second Life10.6 Mb  
44483%10344Template:Conventions2.4 Mb  
42581%5458Talk:Evil Sibe10.8 Mb  
41557%85129Yiff1.1 Mb  
41180%5960WikiFur7.4 Mb  
41060%75128Something Awful5.4 Mb  
40296%1910Equivamp3.7 Mb  
38375%11350WikiFur:Sandbox< 1 Mb  
37584%2417Iguanto Iguana1.7 Mb  
36596%10613User talk:Sine2.1 Mb  
36488%4935Template:Did you know< 1 Mb  
36372%8278Fursuit5.0 Mb  
35264%5646List of fursuit dance competition results7.0 Mb  
34881%6249Category:Websites1.2 Mb  
34594%2419FurNet (IRC)5.8 Mb  
34366%5382Furcadia5.8 Mb  
34258%541034chan2.8 Mb  
34089%4621Talk:Mozdoc12.1 Mb  
33858%69108Anti-furries< 1 Mb  
33783%5438Majira Strawberry3.7 Mb  
33083%2227Connor Goodwolf3.2 Mb  
32364%7468Category:Video games1.0 Mb  
32079%7055WikiFur:Community Central1.3 Mb  
31557%5660List of media links3.1 Mb  
31084%6836WikiFur talk:Comic of the Week/14.7 Mb  
30573%8456Anthrocon3.3 Mb  
30559%5382MILFurs3.5 Mb  
30553%4483E6212.1 Mb  
30367%6872Furry fandom6.4 Mb  
30294%5614User talk:Dmuth4.5 Mb  
30276%4327Nicholas Kruger< 1 Mb  
30063%5152Furry stereotype2.8 Mb  
29564%2019Halfshell Hero2.0 Mb  



jul 2005

1: 2 wikifurries edited WikiFur Furry Central
2: 1 wikifurries edited Furry

ago 2005

1: 19 wikifurries edited Something Awful
2: 16 wikifurries edited ConFurence
3: 11 wikifurries edited Babyfur
4: 10 wikifurries edited Tigerwolf (Tigerden administrator)
5: 10 wikifurries edited List of furry LiveJournal communities
6: 10 wikifurries edited Burned Fur
7: 10 wikifurries edited Necco
8: 10 wikifurries edited Goon
9: 9 wikifurries edited Anti-furries
10: 9 wikifurries edited Ratface
11: 9 wikifurries edited Reddie
12: 9 wikifurries edited Crush! Yiff! Destroy!
13: 9 wikifurries edited DragonFire
14: 9 wikifurries edited Jack (webcomic)
15: 9 wikifurries edited FurryMUCK
16: 8 wikifurries edited Otherkin
17: 8 wikifurries edited LiveJournal
18: 8 wikifurries edited Richard \"Lowtax\" Kyanka
19: 8 wikifurries edited FurFright
20: 8 wikifurries edited HollyAnn
21: 8 wikifurries edited Furcadia
22: 8 wikifurries edited The Lion King
23: 8 wikifurries edited VGCats
24: 8 wikifurries edited Uncle Kage
25: 7 wikifurries edited Sexual orientation

set 2005

1: 11 wikifurries edited Something Awful
2: 10 wikifurries edited List of furry LiveJournal communities
3: 8 wikifurries edited Evil Sibe
4: 8 wikifurries edited Babyfur
5: 7 wikifurries edited Second Life
6: 7 wikifurries edited Furries Against Animal Sexual Abuse
7: 7 wikifurries edited Encyclopædia Dramatica
8: 7 wikifurries edited Vitae
9: 6 wikifurries edited Atladean
10: 6 wikifurries edited Gayfaggotinc
11: 6 wikifurries edited Furry art
12: 5 wikifurries edited Christian Fur
13: 5 wikifurries edited Bob M. Guthrie
14: 5 wikifurries edited PRguitarman
15: 5 wikifurries edited Fox McCloud
16: 5 wikifurries edited Vixen
17: 5 wikifurries edited Banrai
18: 5 wikifurries edited AWFR
19: 5 wikifurries edited AX
20: 5 wikifurries edited Fursona
21: 5 wikifurries edited Feral!
22: 5 wikifurries edited Arcturus
23: 4 wikifurries edited Fox (disambiguation)
24: 4 wikifurries edited Michael Hirtes
25: 4 wikifurries edited Giraffe

out 2005

1: 5 wikifurries edited Dook (sound)
2: 5 wikifurries edited The Amazing Three
3: 5 wikifurries edited YiffNet
4: 4 wikifurries edited Furry
5: 4 wikifurries edited Vixine
6: 4 wikifurries edited Serena
7: 4 wikifurries edited
8: 4 wikifurries edited Furry Fantasies
9: 4 wikifurries edited Bambioid
10: 4 wikifurries edited Twokinds
11: 4 wikifurries edited Florence Ambrose
12: 4 wikifurries edited Squick
13: 4 wikifurries edited Post Pet Momobin
14: 4 wikifurries edited Yerf newsgroups
15: 4 wikifurries edited The Foxbusters
16: 4 wikifurries edited Furtopia
17: 4 wikifurries edited Skiltaire
18: 4 wikifurries edited Creature Comforts (animation)
19: 4 wikifurries edited SoCalFurs
20: 4 wikifurries edited List of furry LiveJournal communities
21: 4 wikifurries edited Midwest FurFest
22: 4 wikifurries edited Doug Winger
23: 4 wikifurries edited Furry fandom
24: 3 wikifurries edited SKORCH
25: 3 wikifurries edited Talking animal

nov 2005

1: 7 wikifurries edited Evil Sibe
2: 7 wikifurries edited Black Tapestries
3: 7 wikifurries edited List of furry LiveJournal communities
4: 7 wikifurries edited Yerf (art archive)
5: 5 wikifurries edited Jakkal
6: 5 wikifurries edited Mephit Mini Con
7: 5 wikifurries edited The Yiffy Guide to Safer Sex
8: 5 wikifurries edited A Doemain of Our Own
9: 5 wikifurries edited Dragonmorph
10: 5 wikifurries edited Avatar Archive
11: 5 wikifurries edited Side 7
12: 5 wikifurries edited SonicBlu Darkfold
13: 5 wikifurries edited Furscape
14: 5 wikifurries edited Lone Wulfe
15: 5 wikifurries edited Vulpyra
16: 5 wikifurries edited Horse
17: 5 wikifurries edited Reddie
18: 5 wikifurries edited Midwest FurFest
19: 5 wikifurries edited Faux Pas
20: 5 wikifurries edited FurryMUCK
21: 4 wikifurries edited Jaybee
22: 4 wikifurries edited Anya Schwartz
23: 4 wikifurries edited PlayMouse
24: 4 wikifurries edited Ravenscroft
25: 4 wikifurries edited Aaaamory

dez 2005

1: 8 wikifurries edited Evil Sibe
2: 7 wikifurries edited Gayfaggotinc
3: 7 wikifurries edited Something Awful
4: 6 wikifurries edited Tigerwolf (Tigerden administrator)
5: 6 wikifurries edited Fur Affinity
6: 5 wikifurries edited TaniDaReal
7: 5 wikifurries edited Jill0r
8: 5 wikifurries edited Anthrocon 2006
9: 5 wikifurries edited Evana Love
10: 5 wikifurries edited Amy the Squirrel
11: 5 wikifurries edited 4chan
12: 4 wikifurries edited Y?
13: 4 wikifurries edited Patch
14: 4 wikifurries edited Bambi's Bamboo Bar
15: 4 wikifurries edited Joshua The Samurai
16: 4 wikifurries edited Human Furry Animals
17: 4 wikifurries edited TF
18: 4 wikifurries edited The Wulf Archives
19: 4 wikifurries edited Purr
20: 4 wikifurries edited Ageplay
21: 4 wikifurries edited High Tail Hall
22: 4 wikifurries edited List of furry LiveJournal communities
23: 4 wikifurries edited Burned Furs
24: 4 wikifurries edited HollyAnn
25: 4 wikifurries edited Fursuit

jan 2006

1: 7 wikifurries edited Kimberleigh Ann Keister
2: 6 wikifurries edited Tank Vixens
3: 5 wikifurries edited Nazi Furs
4: 5 wikifurries edited Iguanto Iguana
5: 5 wikifurries edited Hy00man
6: 5 wikifurries edited Something Awful
7: 4 wikifurries edited Second Life
8: 4 wikifurries edited Michael Hirtes
9: 4 wikifurries edited FyI
10: 4 wikifurries edited Art exchange
11: 4 wikifurries edited Leo Magna
12: 4 wikifurries edited Claw
13: 4 wikifurries edited RuheMaus
14: 4 wikifurries edited Ozone Griffox
15: 4 wikifurries edited The Fauna Project
16: 4 wikifurries edited Kaylee Foxfire
17: 4 wikifurries edited Ricardo Canheta
18: 4 wikifurries edited Balls of Furr
19: 4 wikifurries edited Foxie (IRC)
20: 4 wikifurries edited Adam's Mark
21: 4 wikifurries edited 6-2-1 rule
22: 4 wikifurries edited Foxy Loxy
23: 4 wikifurries edited Shayla the Pink Mouse
24: 4 wikifurries edited Elke
25: 4 wikifurries edited Kristin E.H. Fontaine

fev 2006

1: 5 wikifurries edited FurNation Worlds
2: 5 wikifurries edited Evil Sibe
3: 5 wikifurries edited Mink
4: 5 wikifurries edited Ted Blasingame
5: 5 wikifurries edited Pokémorph MUSH
6: 5 wikifurries edited List of furry LiveJournal communities
7: 4 wikifurries edited Tanabi
8: 4 wikifurries edited Borderlines
9: 4 wikifurries edited Mark Barnard
10: 4 wikifurries edited LondonFur Meet
11: 4 wikifurries edited List of media links
12: 4 wikifurries edited Gayfaggotinc
13: 4 wikifurries edited Bart Bervoets
14: 4 wikifurries edited Kacey Miyagami
15: 4 wikifurries edited Wookiee
16: 4 wikifurries edited Hyper Police
17: 4 wikifurries edited FurryMUCK
18: 3 wikifurries edited Second Life
19: 3 wikifurries edited Rourkie
20: 3 wikifurries edited Alazarin Mondrian
21: 3 wikifurries edited Furryshop
22: 3 wikifurries edited Endless Round MUCK
23: 3 wikifurries edited Starfox MUSH
24: 3 wikifurries edited Four Footed Furries
25: 3 wikifurries edited PosiCat

mar 2006

1: 11 wikifurries edited Neopets
2: 11 wikifurries edited Zarla
3: 11 wikifurries edited Something Awful
4: 10 wikifurries edited Furry Fiesta
5: 10 wikifurries edited Foxyfennec
6: 9 wikifurries edited Las Lindas
7: 9 wikifurries edited
8: 9 wikifurries edited Kittiara (writer)
9: 8 wikifurries edited The American Riviera MUCK
10: 8 wikifurries edited Sholan Alliance
11: 8 wikifurries edited Helix
12: 8 wikifurries edited Thomas K. Dye
13: 8 wikifurries edited Jimmy Chin
14: 8 wikifurries edited Sonic the Hedgehog (franchise)
15: 8 wikifurries edited Fairlight
16: 8 wikifurries edited List of furry LiveJournal communities
17: 8 wikifurries edited JessK
18: 7 wikifurries edited FurVilutionMUCK
19: 7 wikifurries edited Staircon
20: 7 wikifurries edited Latitude MUCK
21: 7 wikifurries edited O'wolf
22: 7 wikifurries edited Shadowcat
23: 7 wikifurries edited Chimera (novel)
24: 7 wikifurries edited Encyclopædia Dramatica
25: 7 wikifurries edited Fox McCloud

abr 2006

1: 9 wikifurries edited Furry
2: 7 wikifurries edited Second Life
3: 6 wikifurries edited Iatro
4: 6 wikifurries edited List of furry LiveJournal communities
5: 6 wikifurries edited Burned Furs
6: 6 wikifurries edited Something Awful
7: 6 wikifurries edited Better Days
8: 5 wikifurries edited FurNation Worlds
9: 5 wikifurries edited Evil Sibe
10: 5 wikifurries edited Snap
11: 5 wikifurries edited Kyo (skunk)
12: 5 wikifurries edited The Den (furry house)
13: 5 wikifurries edited Banrai
14: 5 wikifurries edited Move Your Dead Bones
15: 5 wikifurries edited 4chan
16: 5 wikifurries edited Yiff
17: 5 wikifurries edited FurryMUCK
18: 4 wikifurries edited The Listener
19: 4 wikifurries edited Art show
20: 4 wikifurries edited Happy Tree Friends
21: 4 wikifurries edited SquareMoogle
22: 4 wikifurries edited Spike Nico
23: 4 wikifurries edited CritterConDiego
24: 4 wikifurries edited The Chronicles of Narnia
25: 4 wikifurries edited Amras

mai 2006

1: 8 wikifurries edited List of furry LiveJournal communities
2: 7 wikifurries edited Furry
3: 6 wikifurries edited Yiffy Foxies
4: 6 wikifurries edited Felix Carni
5: 6 wikifurries edited IQ Challenge
6: 6 wikifurries edited BushyCat
7: 6 wikifurries edited Cindi Jimu
8: 6 wikifurries edited Sian Silverhair
9: 6 wikifurries edited Encyclopædia Dramatica
10: 6 wikifurries edited Furry stereotype
11: 6 wikifurries edited Furcadia
12: 5 wikifurries edited The Raccoons
13: 5 wikifurries edited Fritz the Cat
14: 5 wikifurries edited S. Gatsby
15: 5 wikifurries edited Maus
16: 5 wikifurries edited Norn
17: 5 wikifurries edited Max Nighthowl
18: 5 wikifurries edited Rainbow Tiger Radio
19: 5 wikifurries edited Karou Windstalker
20: 5 wikifurries edited List of media links
21: 5 wikifurries edited Growl (person)
22: 5 wikifurries edited Mike Curtis
23: 5 wikifurries edited 4chan
24: 5 wikifurries edited Fursuit
25: 4 wikifurries edited Luca Shoal

jun 2006

1: 13 wikifurries edited Second Life
2: 7 wikifurries edited Anthrocon 2006
3: 7 wikifurries edited List of furry LiveJournal communities
4: 6 wikifurries edited Taurin and the Water Tentacles
5: 6 wikifurries edited Cats
6: 6 wikifurries edited FuzzWolf
7: 6 wikifurries edited AGNPH
8: 6 wikifurries edited Extinctioners
9: 5 wikifurries edited Evil Sibe
10: 5 wikifurries edited Taurin and the Yiffing Machine
11: 5 wikifurries edited Darktiger
12: 5 wikifurries edited Grimmutt
13: 4 wikifurries edited Mazz
14: 4 wikifurries edited Xanni The Blue
15: 4 wikifurries edited Pika
16: 4 wikifurries edited Solion
17: 4 wikifurries edited Dex
18: 4 wikifurries edited FoxWolfie Galen
19: 4 wikifurries edited Ty the Tasmanian Tiger
20: 4 wikifurries edited Rendal's Ravings
21: 4 wikifurries edited Fisk Black
22: 4 wikifurries edited Larathen
23: 4 wikifurries edited Invader Pichu
24: 4 wikifurries edited Nevar Felrnn
25: 4 wikifurries edited Feasox

jul 2006

1: 9 wikifurries edited FurFest Northwest
2: 8 wikifurries edited Anthrocon 2006
3: 8 wikifurries edited Furtopia
4: 8 wikifurries edited Agahnim
5: 8 wikifurries edited List of furry LiveJournal communities
6: 8 wikifurries edited Furcadia
7: 7 wikifurries edited WikiFur
8: 7 wikifurries edited Wicked Sairah
9: 7 wikifurries edited 2, The Ranting Gryphon
10: 7 wikifurries edited List of media links
11: 7 wikifurries edited What is Furry?
12: 7 wikifurries edited Encyclopædia Dramatica
13: 6 wikifurries edited Bucky Whitetail
14: 6 wikifurries edited PAINWOLF
15: 6 wikifurries edited Meet the \"Furries\"
16: 6 wikifurries edited Mik Genocide
17: 6 wikifurries edited 4chan
18: 6 wikifurries edited Furry fandom
19: 5 wikifurries edited EFudd
20: 5 wikifurries edited Roj Adrik
21: 5 wikifurries edited Jwoulf
22: 5 wikifurries edited WTFur
23: 5 wikifurries edited Furmont
24: 5 wikifurries edited Tina Hopster
25: 5 wikifurries edited MechaRoos

ago 2006

1: 14 wikifurries edited Fur Affinity
2: 9 wikifurries edited Furry fandom
3: 8 wikifurries edited FurNation Worlds
4: 8 wikifurries edited List of furry LiveJournal communities
5: 8 wikifurries edited 4chan
6: 8 wikifurries edited Fursecution
7: 8 wikifurries edited Furcadia
8: 7 wikifurries edited WTFur
9: 7 wikifurries edited FurFest Northwest
10: 6 wikifurries edited Wife Swap
11: 6 wikifurries edited Silver R. Wolfe
12: 6 wikifurries edited List of in-person furry conventions by attendance
13: 6 wikifurries edited The Anthroness
14: 6 wikifurries edited Encyclopædia Dramatica
15: 6 wikifurries edited FurBid-SF
16: 6 wikifurries edited Bestiality
17: 6 wikifurries edited GreenReaper
18: 5 wikifurries edited Mazz
19: 5 wikifurries edited Eric Boot
20: 5 wikifurries edited Cobalt (Delos)
21: 5 wikifurries edited KatzeDrache
22: 5 wikifurries edited Sabbath Da' Frog
23: 5 wikifurries edited Peace Chanticleer
24: 5 wikifurries edited Padfoot (artist)
25: 5 wikifurries edited Scott Malcomson

set 2006

1: 15 wikifurries edited Evil Sibe
2: 7 wikifurries edited The Furry Song
3: 7 wikifurries edited Babyfur
4: 6 wikifurries edited Second Life
5: 6 wikifurries edited Furry Teens
6: 6 wikifurries edited Naros
7: 6 wikifurries edited List of characters in The Anthroness
8: 6 wikifurries edited Pegla
9: 6 wikifurries edited List of furry LiveJournal communities
10: 5 wikifurries edited Furry
11: 5 wikifurries edited The Private Life of The Rabbit
12: 5 wikifurries edited Empires
13: 5 wikifurries edited Polska Strefa Furry
14: 5 wikifurries edited RaptorianOne
15: 5 wikifurries edited Dr. Foxy Trinity
16: 5 wikifurries edited Kasi Frost
17: 5 wikifurries edited Kanapi
18: 5 wikifurries edited ForcesWerwolf
19: 5 wikifurries edited Winterbalg
20: 5 wikifurries edited Zachary French
21: 5 wikifurries edited Beeps
22: 5 wikifurries edited Westhaven
23: 5 wikifurries edited Encyclopædia Dramatica
24: 5 wikifurries edited Fur
25: 5 wikifurries edited Krystal

out 2006

1: 7 wikifurries edited Encyclopædia Dramatica
2: 7 wikifurries edited Crush! Yiff! Destroy!
3: 7 wikifurries edited Yerf (art archive)
4: 6 wikifurries edited Second Life
5: 6 wikifurries edited Zippo
6: 6 wikifurries edited Xanni The Blue
7: 6 wikifurries edited Sly Rabbit
8: 6 wikifurries edited Furtopia
9: 6 wikifurries edited Fchan
10: 5 wikifurries edited Fur Weekend Camping & BBQ
11: 5 wikifurries edited Tyr Perhaps
12: 5 wikifurries edited Murreki
13: 5 wikifurries edited StarChaser
14: 5 wikifurries edited Art piracy
15: 5 wikifurries edited Zel al'Ter
16: 5 wikifurries edited Nanaku
17: 5 wikifurries edited The Lion King/Who was the cub?
18: 5 wikifurries edited ScribbleFox
19: 5 wikifurries edited Howloween
20: 5 wikifurries edited List of furry LiveJournal communities
21: 4 wikifurries edited Perro
22: 4 wikifurries edited Kat Smith
23: 4 wikifurries edited Digi-Pig
24: 4 wikifurries edited Immelmann
25: 4 wikifurries edited AOD Enigma

nov 2006

1: 8 wikifurries edited List of furry LiveJournal communities
2: 6 wikifurries edited Fur Affinity
3: 5 wikifurries edited Al Davis
4: 5 wikifurries edited Blackpaw Badger
5: 5 wikifurries edited Purple Pussy
6: 5 wikifurries edited Shadowfox (person)
7: 5 wikifurries edited Lapism
8: 5 wikifurries edited Michele Light
9: 5 wikifurries edited Something Awful
10: 4 wikifurries edited Furry convention
11: 4 wikifurries edited Zack Barzahd
12: 4 wikifurries edited Roum
13: 4 wikifurries edited Cain
14: 4 wikifurries edited Klisoura
15: 4 wikifurries edited ErrorWolf
16: 4 wikifurries edited AokiBengal
17: 4 wikifurries edited Nrr
18: 4 wikifurries edited Hvilket dyr er du?
19: 4 wikifurries edited Aerion
20: 4 wikifurries edited CyberFox
21: 4 wikifurries edited Rattuskid
22: 4 wikifurries edited HammyToy
23: 4 wikifurries edited Eurofurence 13
24: 4 wikifurries edited Ragnah'reknik
25: 4 wikifurries edited Bert

dez 2006

1: 11 wikifurries edited Halfshell Hero
2: 10 wikifurries edited Encyclopædia Dramatica
3: 8 wikifurries edited Rotten Furs
4: 7 wikifurries edited DiveFox
5: 6 wikifurries edited Tensai Nezumi
6: 6 wikifurries edited Paiseley
7: 6 wikifurries edited Blueberry
8: 6 wikifurries edited Stacey
9: 6 wikifurries edited Ziba
10: 6 wikifurries edited Sema JayHawk
11: 6 wikifurries edited Taren Nauxen
12: 6 wikifurries edited List of media links
13: 6 wikifurries edited High Tail Hall
14: 5 wikifurries edited Rain Silves
15: 5 wikifurries edited Wipeout Comics
16: 5 wikifurries edited UnicornSpirit
17: 5 wikifurries edited Hex
18: 5 wikifurries edited Untamed Hearts
19: 5 wikifurries edited Arazia
20: 5 wikifurries edited Sidechan
21: 5 wikifurries edited The Sonic God
22: 5 wikifurries edited Arashi No Yoru Ni
23: 5 wikifurries edited SliderCon
24: 5 wikifurries edited Furfag
25: 5 wikifurries edited Kalus

jan 2007

1: 7 wikifurries edited Sidechan
2: 6 wikifurries edited Aphinity
3: 6 wikifurries edited Miki WhiteEye
4: 6 wikifurries edited Evis
5: 6 wikifurries edited Plas
6: 6 wikifurries edited 7chan
7: 6 wikifurries edited Gay Yiffy Club
8: 6 wikifurries edited Furry Wrestling Alliance
9: 6 wikifurries edited Further Confusion 2007
10: 6 wikifurries edited Jay Naylor
11: 5 wikifurries edited Jay Wolf
12: 5 wikifurries edited Rokko WhiteEye
13: 5 wikifurries edited New Year's Furry Ball
14: 5 wikifurries edited DLNorton
15: 5 wikifurries edited Lackadaisy
16: 5 wikifurries edited Sayai Wolff
17: 5 wikifurries edited Sunrise MUCK
18: 5 wikifurries edited Extinctioners
19: 5 wikifurries edited 4chan
20: 4 wikifurries edited Netami Kitchkinet
21: 4 wikifurries edited TBFM
22: 4 wikifurries edited Kraken D'Waggin
23: 4 wikifurries edited Chmarr Walcott
24: 4 wikifurries edited TheBunnyMan
25: 4 wikifurries edited Vegas Furs

fev 2007

1: 11 wikifurries edited Conifur Northwest
2: 7 wikifurries edited PhiPaw
3: 7 wikifurries edited High Tail Hall
4: 6 wikifurries edited Taryn
5: 6 wikifurries edited Knuffy
6: 6 wikifurries edited SliderCon
7: 6 wikifurries edited SPH
8: 6 wikifurries edited List of furry LiveJournal communities
9: 6 wikifurries edited Crush! Yiff! Destroy!
10: 5 wikifurries edited Razi (IMVU skinner)
11: 5 wikifurries edited
12: 5 wikifurries edited Mephit Fur Meet X
13: 5 wikifurries edited Conifur Northwest 2005
14: 5 wikifurries edited GreenReaper
15: 4 wikifurries edited Balloonie
16: 4 wikifurries edited
17: 4 wikifurries edited Wolfee Darkfang
18: 4 wikifurries edited WikiFur
19: 4 wikifurries edited Riley Westwolf
20: 4 wikifurries edited Godiva the Chocolate Skunk
21: 4 wikifurries edited Kitoichi Aoiro
22: 4 wikifurries edited Kogenta
23: 4 wikifurries edited Nephilim
24: 4 wikifurries edited Blue
25: 4 wikifurries edited Blue anthroraptor

mar 2007

1: 7 wikifurries edited Furry
2: 6 wikifurries edited RenoFurries
3: 6 wikifurries edited Tahoe Mustelidae
4: 6 wikifurries edited RainFurrest
5: 6 wikifurries edited The Lion King MUCK
6: 5 wikifurries edited Destroying the Illusion
7: 5 wikifurries edited Pawspace.commons
8: 5 wikifurries edited AC in SL
9: 5 wikifurries edited Purple Pussy
10: 5 wikifurries edited NorthEast Ohio Furs
11: 5 wikifurries edited List of furry LiveJournal communities
12: 5 wikifurries edited Yiff
13: 5 wikifurries edited The Lion King
14: 4 wikifurries edited Second Life
15: 4 wikifurries edited Doc The Coyote
16: 4 wikifurries edited Trinton Chronicles
17: 4 wikifurries edited Tumbles the Stairdragon
18: 4 wikifurries edited Arc
19: 4 wikifurries edited PandaGuy
20: 4 wikifurries edited Splash
21: 4 wikifurries edited World Gates
22: 4 wikifurries edited Jack (character)
23: 4 wikifurries edited SunsetDrake
24: 4 wikifurries edited Timeline of media coverage
25: 4 wikifurries edited ConFuzzled

abr 2007

1: 11 wikifurries edited The Lining
2: 10 wikifurries edited Banrai
3: 8 wikifurries edited Jurann
4: 7 wikifurries edited Furry
5: 7 wikifurries edited K'sharra
6: 7 wikifurries edited Yiff
7: 6 wikifurries edited Lizardman
8: 6 wikifurries edited ShadoWolffess
9: 6 wikifurries edited Kay Fedewa
10: 6 wikifurries edited SliderCon
11: 6 wikifurries edited Kacey Miyagami
12: 6 wikifurries edited List of furry LiveJournal communities
13: 6 wikifurries edited Something Awful
14: 5 wikifurries edited CarolinaFurs
15: 5 wikifurries edited Therianthropy
16: 5 wikifurries edited Soki Twopaw
17: 5 wikifurries edited Swane
18: 5 wikifurries edited Xyzzy
19: 5 wikifurries edited Purple Pussy
20: 5 wikifurries edited All Fur Fun
21: 5 wikifurries edited StarrBucks
22: 5 wikifurries edited Atara
23: 5 wikifurries edited Encyclopædia Dramatica
24: 5 wikifurries edited Kimberleigh Ann Keister
25: 5 wikifurries edited Babyfur

mai 2007

1: 9 wikifurries edited Pouchhopper
2: 9 wikifurries edited List of furry LiveJournal communities
3: 7 wikifurries edited Jackie (person)
4: 7 wikifurries edited Mozdoc
5: 7 wikifurries edited Jwoulf
6: 6 wikifurries edited Furry
7: 6 wikifurries edited Volk
8: 6 wikifurries edited Folfed!
9: 6 wikifurries edited Mazz
10: 6 wikifurries edited Rocket City FurMeet
11: 6 wikifurries edited Fur Affinity
12: 5 wikifurries edited
13: 5 wikifurries edited Eratu
14: 5 wikifurries edited Xanthe
15: 5 wikifurries edited Louisiana Furs
16: 5 wikifurries edited Skwerl
17: 5 wikifurries edited Topher Fox
18: 5 wikifurries edited Mousey Love Girls
19: 5 wikifurries edited JTigerclaw
20: 5 wikifurries edited Califur 3
21: 5 wikifurries edited List of in-person furry conventions by attendance
22: 5 wikifurries edited
23: 5 wikifurries edited Encyclopædia Dramatica
24: 5 wikifurries edited Ursa Major Awards
25: 5 wikifurries edited Further Confusion

jun 2007

1: 8 wikifurries edited GreenReaper
2: 7 wikifurries edited Cizkaro
3: 7 wikifurries edited Kit Karamak
4: 7 wikifurries edited Encyclopædia Dramatica
5: 6 wikifurries edited Character sheet
6: 6 wikifurries edited Therianthropy
7: 6 wikifurries edited Sema JayHawk
8: 6 wikifurries edited List of furry LiveJournal communities
9: 5 wikifurries edited Furry
10: 5 wikifurries edited Cougar Leon
11: 5 wikifurries edited Pawz Davis
12: 5 wikifurries edited March of the Furries
13: 5 wikifurries edited Loupgaros
14: 5 wikifurries edited Rhianna Ravenclaw
15: 5 wikifurries edited LAFF New Years Eve
16: 5 wikifurries edited Mousey Love Girls
17: 5 wikifurries edited Evil Sibe
18: 5 wikifurries edited Rootdown
19: 5 wikifurries edited Kitsune (mythology)
20: 5 wikifurries edited Furry fandom
21: 4 wikifurries edited Second Life
22: 4 wikifurries edited JoeCWolf
23: 4 wikifurries edited Diana Vick
24: 4 wikifurries edited Riff-Raff
25: 4 wikifurries edited Breathfur2

jul 2007

1: 12 wikifurries edited Anthrocon 2007
2: 9 wikifurries edited King Elliott Ingonyama the First
3: 7 wikifurries edited Second Life
4: 6 wikifurries edited Krystal can't enjoy her sandwich
5: 6 wikifurries edited Elliott's Live Events
6: 6 wikifurries edited Lazerus101
7: 6 wikifurries edited Soki Twopaw
8: 6 wikifurries edited The Furluminati
9: 5 wikifurries edited Koro (person)
10: 5 wikifurries edited Snug-a-Lot Bear
11: 5 wikifurries edited Rakeesh
12: 5 wikifurries edited Kitty Mikazuki
13: 5 wikifurries edited Furry Tales
14: 5 wikifurries edited Lucky Coyote
15: 5 wikifurries edited Cbee
16: 5 wikifurries edited Dingbat
17: 5 wikifurries edited 7chan
18: 5 wikifurries edited Timeline of media coverage
19: 5 wikifurries edited Cats
20: 5 wikifurries edited Banrai
21: 5 wikifurries edited Califur
22: 5 wikifurries edited Anthrocon
23: 4 wikifurries edited Love Can Be Different
24: 4 wikifurries edited Njhcerebus
25: 4 wikifurries edited Telos

ago 2007

1: 7 wikifurries edited Second Life
2: 7 wikifurries edited List of in-person furry conventions by attendance
3: 6 wikifurries edited Evil Sibe
4: 6 wikifurries edited Anthrocon 2007
5: 5 wikifurries edited Furry
6: 5 wikifurries edited Hugh Manatee
7: 5 wikifurries edited Elfasi
8: 5 wikifurries edited FA: United
9: 5 wikifurries edited Kindrift
10: 5 wikifurries edited Star Fox
11: 5 wikifurries edited Yiff
12: 4 wikifurries edited Prox
13: 4 wikifurries edited WolfQuest
14: 4 wikifurries edited Amethe
15: 4 wikifurries edited Pyro (artist)
16: 4 wikifurries edited Silver and Sage
17: 4 wikifurries edited KojakWolf
18: 4 wikifurries edited Sajin Komamura
19: 4 wikifurries edited Keeper Of Dreams
20: 4 wikifurries edited FURst CONtact
21: 4 wikifurries edited Kittenkeiko
22: 4 wikifurries edited Lokosicek
23: 4 wikifurries edited The Milkshake Club
24: 4 wikifurries edited MeshGearFox
25: 4 wikifurries edited Alvin and the Chipmunks

set 2007

1: 9 wikifurries edited List of furry LiveJournal communities
2: 7 wikifurries edited Vorderman
3: 6 wikifurries edited ShadowPheonix
4: 6 wikifurries edited Immelmann
5: 5 wikifurries edited KO Fighter
6: 5 wikifurries edited Kixt Norkazz
7: 5 wikifurries edited All Fur Fun
8: 5 wikifurries edited 2, The Ranting Gryphon
9: 5 wikifurries edited Carpe Diem
10: 4 wikifurries edited Roxwood
11: 4 wikifurries edited Rasasha
12: 4 wikifurries edited Geist
13: 4 wikifurries edited Casidhe
14: 4 wikifurries edited Tabyathe
15: 4 wikifurries edited Yotie
16: 4 wikifurries edited Cane McKeyton
17: 4 wikifurries edited Mozdoc
18: 4 wikifurries edited Kitmouse
19: 4 wikifurries edited ANTIcarrot
20: 4 wikifurries edited RainFurrest
21: 4 wikifurries edited Blue Panther
22: 4 wikifurries edited List of furs who were married at a furry con
23: 4 wikifurries edited Conbadge
24: 3 wikifurries edited WikiFur
25: 3 wikifurries edited SyrielTiger

out 2007

1: 7 wikifurries edited Mephit Fur Meet X
2: 6 wikifurries edited Iguanto Iguana
3: 6 wikifurries edited List of furry LiveJournal communities
4: 5 wikifurries edited Furry
5: 5 wikifurries edited MewYear
6: 5 wikifurries edited Colley
7: 5 wikifurries edited Encyclopædia Dramatica
8: 5 wikifurries edited Something Awful
9: 4 wikifurries edited Faytus
10: 4 wikifurries edited Fritzy Wolf
11: 4 wikifurries edited FoxBoom
12: 4 wikifurries edited Kayleigh Stone
13: 4 wikifurries edited Axle (UK)
14: 4 wikifurries edited Crush! Yiff! Destroy!
15: 3 wikifurries edited Smokescale
16: 3 wikifurries edited Second Life
17: 3 wikifurries edited Vixx Fox
18: 3 wikifurries edited Shadow-da-wolf
19: 3 wikifurries edited Ryshili
20: 3 wikifurries edited Shy Cry Wolf
21: 3 wikifurries edited SonOfOsiris
22: 3 wikifurries edited Wyvern
23: 3 wikifurries edited Furry Pride
24: 3 wikifurries edited BritFur FM
25: 3 wikifurries edited FURconsin

nov 2007

1: 7 wikifurries edited Furry
2: 5 wikifurries edited FastClaw
3: 5 wikifurries edited MaTeR
4: 5 wikifurries edited RBW
5: 5 wikifurries edited ForcesWerwolf
6: 5 wikifurries edited Fursona
7: 5 wikifurries edited Yiffstar
8: 4 wikifurries edited Tikky
9: 4 wikifurries edited Furventure
10: 4 wikifurries edited Midwest FurFest 2008
11: 4 wikifurries edited Che'samo
12: 4 wikifurries edited Tokala (United States)
13: 4 wikifurries edited BlindWolf8
14: 4 wikifurries edited TOS
15: 4 wikifurries edited Midwest FurFest 2007
16: 4 wikifurries edited Aerusales Phox
17: 4 wikifurries edited NickerEquinian
18: 4 wikifurries edited FurJAM
19: 4 wikifurries edited DarkenTiger
20: 4 wikifurries edited ConFuzzled
21: 4 wikifurries edited RainFurrest
22: 4 wikifurries edited Post-con depression
23: 4 wikifurries edited Fursuit
24: 3 wikifurries edited Darwin's Fox
25: 3 wikifurries edited Koba Foxx

dez 2007

1: 8 wikifurries edited Furry
2: 7 wikifurries edited Fursecution
3: 5 wikifurries edited At the Heart of it All
4: 5 wikifurries edited Powerful Horse
5: 5 wikifurries edited RainFurrest 2008
6: 5 wikifurries edited Wandering Eccentric
7: 5 wikifurries edited Otherkin
8: 4 wikifurries edited The GhostPony
9: 4 wikifurries edited Jocasta
10: 4 wikifurries edited Vikali
11: 4 wikifurries edited Define \"Cynical\"
12: 4 wikifurries edited Cabbit
13: 4 wikifurries edited Wildfox
14: 4 wikifurries edited Mozdoc
15: 4 wikifurries edited RBW
16: 4 wikifurries edited List of furry LiveJournal communities
17: 4 wikifurries edited Anti-furries
18: 4 wikifurries edited Fchan
19: 3 wikifurries edited Darky (Ralarare)
20: 3 wikifurries edited Luca Shoal
21: 3 wikifurries edited Natasha Softpaw
22: 3 wikifurries edited WikiFur
23: 3 wikifurries edited Sheba Wolf
24: 3 wikifurries edited RBW 2008
25: 3 wikifurries edited Acroth

jan 2008

1: 11 wikifurries edited Furry
2: 8 wikifurries edited Furry fandom
3: 7 wikifurries edited Sexual orientation
4: 6 wikifurries edited Mozdoc
5: 6 wikifurries edited Bucky Rabbit
6: 6 wikifurries edited Otherkin
7: 6 wikifurries edited List of furry LiveJournal communities
8: 5 wikifurries edited Luca Shoal
9: 5 wikifurries edited Sodders
10: 5 wikifurries edited Evil Sibe
11: 4 wikifurries edited Gray Coyote
12: 4 wikifurries edited Alaskan MUCK
13: 4 wikifurries edited Steven R. Boyett
14: 4 wikifurries edited Vivisector (website)
15: 4 wikifurries edited Gwyndolium
16: 4 wikifurries edited Killer Dragon
17: 4 wikifurries edited WikiFur
18: 4 wikifurries edited Concession
19: 4 wikifurries edited ConFuzzled
20: 4 wikifurries edited Babyfur
21: 4 wikifurries edited Yiff
22: 4 wikifurries edited Fursuit
23: 3 wikifurries edited Exi
24: 3 wikifurries edited Second Life
25: 3 wikifurries edited Kappa

fev 2008

1: 7 wikifurries edited Sage Nadia
2: 6 wikifurries edited Furry
3: 5 wikifurries edited Big Daddy Cruel
4: 5 wikifurries edited Timeline of media coverage
5: 5 wikifurries edited List of in-person furry conventions by attendance
6: 5 wikifurries edited List of furry LiveJournal communities
7: 4 wikifurries edited Circles
8: 4 wikifurries edited Hwei Chow
9: 4 wikifurries edited Striker King Cheetah
10: 4 wikifurries edited Tame Wolf
11: 4 wikifurries edited The Fursuit Archive
12: 4 wikifurries edited Roman Beattie
13: 4 wikifurries edited
14: 4 wikifurries edited Wajas
15: 3 wikifurries edited SheBa
16: 3 wikifurries edited Business or Pleasure
17: 3 wikifurries edited Andrew Finney
18: 3 wikifurries edited Miyabi
19: 3 wikifurries edited Tav Windpaw
20: 3 wikifurries edited Sarin Kilgare
21: 3 wikifurries edited Zephyr Panthur
22: 3 wikifurries edited MalaikaWolfcat
23: 3 wikifurries edited Frost T. Wolf
24: 3 wikifurries edited Ness
25: 3 wikifurries edited Kitaro Algazi

mar 2008

1: 6 wikifurries edited Timon b
2: 5 wikifurries edited Furthia High
3: 5 wikifurries edited BigDaddyBear
4: 5 wikifurries edited Sydney Gay and Lesbian Mardi Gras
5: 4 wikifurries edited Circles
6: 4 wikifurries edited Wolfee Darkfang
7: 4 wikifurries edited Arianna Michalak
8: 4 wikifurries edited Rez Radgrif
9: 4 wikifurries edited QuetzaDrake
10: 4 wikifurries edited Furpile Radio
11: 4 wikifurries edited Assassin2684
12: 4 wikifurries edited Hornwolf
13: 4 wikifurries edited Tire
14: 4 wikifurries edited ArcticKiba
15: 4 wikifurries edited Koi Lovecarp
16: 4 wikifurries edited SparkyBlueFox
17: 4 wikifurries edited Rather Dashing
18: 4 wikifurries edited Furry
19: 4 wikifurries edited BritFur FM
20: 4 wikifurries edited Wajas
21: 4 wikifurries edited List of furry LiveJournal communities
22: 3 wikifurries edited LapFox Trax
23: 3 wikifurries edited CC2iscooL
24: 3 wikifurries edited Volvo
25: 3 wikifurries edited YouTube Furry War

abr 2008

1: 7 wikifurries edited Alexander Wolf
2: 6 wikifurries edited DustyKat
3: 5 wikifurries edited Wolfee Darkfang
4: 5 wikifurries edited Sebek Umber
5: 5 wikifurries edited Kaiya Jounestu
6: 5 wikifurries edited Furry
7: 5 wikifurries edited MyFursona
8: 5 wikifurries edited Megaplex
9: 4 wikifurries edited LupineFox
10: 4 wikifurries edited Shippou Softpaw
11: 4 wikifurries edited Aegis
12: 4 wikifurries edited MagnusSerra
13: 4 wikifurries edited Eric Fox
14: 4 wikifurries edited The Cunning Little Vixen
15: 4 wikifurries edited Aetobatus
16: 4 wikifurries edited Fandom's Favorite Fursuit Fracas 2008
17: 4 wikifurries edited YiffyToys (name dispute)
18: 4 wikifurries edited Furry Fiesta
19: 3 wikifurries edited Luca Shoal
20: 3 wikifurries edited JarekoJosh
21: 3 wikifurries edited Rhylith
22: 3 wikifurries edited Jess Hillard
23: 3 wikifurries edited Drakkoid
24: 3 wikifurries edited NinjaWulf
25: 3 wikifurries edited FetishZone

mai 2008

1: 8 wikifurries edited Circles
2: 8 wikifurries edited Straitfox
3: 7 wikifurries edited Furry
4: 7 wikifurries edited Megaplex
5: 6 wikifurries edited Tales from the Reservation
6: 6 wikifurries edited Mozdoc
7: 6 wikifurries edited List of furry LiveJournal communities
8: 5 wikifurries edited Wolfsangel Slade
9: 5 wikifurries edited Fandom's Favorite Fursuit Fracas 2008
10: 5 wikifurries edited Shadowpelt
11: 5 wikifurries edited Toronto Furry
12: 4 wikifurries edited Kat Vixen
13: 4 wikifurries edited WikiFur
14: 4 wikifurries edited Greek mythology
15: 4 wikifurries edited Mousey Love Girls
16: 4 wikifurries edited Evil Sibe
17: 4 wikifurries edited The Pack MUCK
18: 4 wikifurries edited Furry art
19: 4 wikifurries edited Califur
20: 4 wikifurries edited Yiff
21: 3 wikifurries edited Second Life
22: 3 wikifurries edited Natasha Softpaw
23: 3 wikifurries edited Daelyhel Axon
24: 3 wikifurries edited Barkoholic
25: 3 wikifurries edited Zapnut Shakur

jun 2008

1: 12 wikifurries edited Furry
2: 8 wikifurries edited Megaplex
3: 6 wikifurries edited Wolfee Darkfang
4: 5 wikifurries edited Anti-Furry Coalition
5: 5 wikifurries edited Mozdoc
6: 4 wikifurries edited Luke Mortora
7: 4 wikifurries edited Graymalkin
8: 4 wikifurries edited Daelyhel Axon
9: 4 wikifurries edited Fixed Furs
10: 4 wikifurries edited Mephit Fur Meet 12
11: 4 wikifurries edited Taral Wayne
12: 4 wikifurries edited Mephit Furmeet
13: 4 wikifurries edited Anthrocon
14: 3 wikifurries edited Circles
15: 3 wikifurries edited Zaishi Mai
16: 3 wikifurries edited Cologne Furdance
17: 3 wikifurries edited Luke Mortora: The Dawn Chorus
18: 3 wikifurries edited Cosmo
19: 3 wikifurries edited Mario A. Romero
20: 3 wikifurries edited The Ratacombs
21: 3 wikifurries edited Fangz (Norway)
22: 3 wikifurries edited Furrum
23: 3 wikifurries edited Shot King
24: 3 wikifurries edited Anthroverse
25: 3 wikifurries edited Taking Up Space

jul 2008

1: 9 wikifurries edited Mozdoc
2: 9 wikifurries edited Fur Affinity
3: 7 wikifurries edited Uncle Kage
4: 6 wikifurries edited Second Life
5: 6 wikifurries edited Brute Gryphons
6: 6 wikifurries edited Gryph Sylvr
7: 5 wikifurries edited
8: 5 wikifurries edited Kage Wuffy
9: 5 wikifurries edited Goof Troop
10: 5 wikifurries edited FoxSan Yosuké
11: 5 wikifurries edited Fuzzy Husky
12: 5 wikifurries edited Sairys Wolf
13: 5 wikifurries edited Straitfox
14: 5 wikifurries edited Thaily Brimstone
15: 4 wikifurries edited ConFurtiva
16: 4 wikifurries edited GRPG:SE
17: 4 wikifurries edited OverGryph
18: 4 wikifurries edited L.Z.Z. Littlething
19: 4 wikifurries edited Gryphons of the Mist
20: 4 wikifurries edited Crimson Star
21: 4 wikifurries edited Furry Times
22: 4 wikifurries edited Mouseboy
23: 4 wikifurries edited Neko Haiku
24: 4 wikifurries edited ScottWolf
25: 4 wikifurries edited Pede (DMFA)

ago 2008

1: 7 wikifurries edited Tidal Wolf
2: 7 wikifurries edited Fur Affinity
3: 5 wikifurries edited Rockfanatik
4: 5 wikifurries edited Wolfie Rankin
5: 5 wikifurries edited
6: 5 wikifurries edited Ryan Dewalt
7: 4 wikifurries edited Nox Darkpaw
8: 4 wikifurries edited Icefox
9: 4 wikifurries edited Fur Haven Forums
10: 4 wikifurries edited Caer Carnivore
11: 4 wikifurries edited Furry
12: 4 wikifurries edited Straitfox
13: 4 wikifurries edited Furry Art Pile
14: 4 wikifurries edited Burned Furs
15: 3 wikifurries edited Hideki
16: 3 wikifurries edited Milkshakes
17: 3 wikifurries edited Dropout Bear
18: 3 wikifurries edited Zerox Rezonium
19: 3 wikifurries edited Zalno
20: 3 wikifurries edited Jynx Darkwulf
21: 3 wikifurries edited Miktar
22: 3 wikifurries edited Kis Kisaryu
23: 3 wikifurries edited SpiritWolven
24: 3 wikifurries edited Kitsuria Network
25: 3 wikifurries edited Furball Run

set 2008

1: 6 wikifurries edited Uncle Kage
2: 5 wikifurries edited By The Tail
3: 5 wikifurries edited Furry Enforcement Agency
4: 5 wikifurries edited Furry
5: 5 wikifurries edited WikiFur
6: 5 wikifurries edited Furry Art Pile
7: 5 wikifurries edited 4chan
8: 4 wikifurries edited Shenro
9: 4 wikifurries edited Equium
10: 4 wikifurries edited Mick Collins
11: 4 wikifurries edited The Dirtbombs
12: 4 wikifurries edited Dusty Yote
13: 4 wikifurries edited 2 Sense 2.0
14: 4 wikifurries edited Komica
15: 4 wikifurries edited The Y100
16: 4 wikifurries edited Eurofurence 14
17: 4 wikifurries edited RBW
18: 4 wikifurries edited \"Furry\"ness
19: 4 wikifurries edited 2, The Ranting Gryphon
20: 4 wikifurries edited List of in-person furry conventions by attendance
21: 4 wikifurries edited Yiff
22: 4 wikifurries edited Fur Affinity
23: 3 wikifurries edited RabidRaccoon (artist)
24: 3 wikifurries edited Frazzle
25: 3 wikifurries edited Garinovitch Raviprakash

out 2008

1: 6 wikifurries edited High Tail Hall 2.0
2: 6 wikifurries edited Furry
3: 5 wikifurries edited Mark Allen's Pet Project
4: 5 wikifurries edited Arcania
5: 5 wikifurries edited American Dad!
6: 5 wikifurries edited Stuart Otterson
7: 5 wikifurries edited Furry Pride
8: 4 wikifurries edited FURNAM
9: 4 wikifurries edited Wolfee Darkfang
10: 4 wikifurries edited MiJynx
11: 4 wikifurries edited Lopoddity
12: 4 wikifurries edited
13: 4 wikifurries edited
14: 4 wikifurries edited Natasha Softpaw
15: 4 wikifurries edited Islands and other locations in Second Life
16: 4 wikifurries edited Furthia High
17: 4 wikifurries edited WikiFur
18: 4 wikifurries edited Telos
19: 4 wikifurries edited Toast the Rabbit
20: 4 wikifurries edited Chimera Synx
21: 3 wikifurries edited Steam (United Kingdom)
22: 3 wikifurries edited Manny
23: 3 wikifurries edited Xerxes Bastuk
24: 3 wikifurries edited Anaheim Fur House
25: 3 wikifurries edited TotemChakra

nov 2008

1: 6 wikifurries edited Darkdoomer
2: 6 wikifurries edited Furry fandom
3: 5 wikifurries edited Zementh
4: 5 wikifurries edited Furry
5: 4 wikifurries edited Damon Husky
6: 4 wikifurries edited FurSpace
7: 4 wikifurries edited Russian WikiFur
8: 4 wikifurries edited Sin Kaline
9: 4 wikifurries edited Tiger Sammy
10: 4 wikifurries edited The Den (forum)
11: 4 wikifurries edited Mephit Fur Meet X
12: 4 wikifurries edited List of furry LiveJournal communities
13: 3 wikifurries edited Savrin Drake
14: 3 wikifurries edited Stathgar
15: 3 wikifurries edited Wereandrewtiger
16: 3 wikifurries edited Azra
17: 3 wikifurries edited Hideki
18: 3 wikifurries edited Mpregfur
19: 3 wikifurries edited Eeve3
20: 3 wikifurries edited Mahrkale
21: 3 wikifurries edited Foxchild
22: 3 wikifurries edited
23: 3 wikifurries edited Fire Dragon
24: 3 wikifurries edited Wuffsky
25: 3 wikifurries edited Drakon E. Go

dez 2008

1: 7 wikifurries edited Furry
2: 5 wikifurries edited CelestialWolfen
3: 5 wikifurries edited Furfag
4: 4 wikifurries edited Kitsunechao
5: 4 wikifurries edited Owens Whitcroft
6: 4 wikifurries edited Karuza
7: 4 wikifurries edited Comah
8: 4 wikifurries edited TrueFurry
9: 4 wikifurries edited Bluepawz
10: 4 wikifurries edited High Tail Hall 2.0
11: 4 wikifurries edited WikiFur
12: 4 wikifurries edited Furry Hosting
13: 4 wikifurries edited Furry Pride
14: 4 wikifurries edited Jibba Foxcoon
15: 4 wikifurries edited Vancouver Island Furs
16: 4 wikifurries edited Bowman's Wolf
17: 4 wikifurries edited 4chan
18: 3 wikifurries edited Sandy Sagebrush
19: 3 wikifurries edited Dog
20: 3 wikifurries edited NeoScribbles
21: 3 wikifurries edited Industrial Frost
22: 3 wikifurries edited Kalida
23: 3 wikifurries edited Kali
24: 3 wikifurries edited ChinchillaFoxCat
25: 3 wikifurries edited Motofox

jan 2009

1: 6 wikifurries edited List of furry LiveJournal communities
2: 5 wikifurries edited Dr.Pawz
3: 5 wikifurries edited Seth Rayburd
4: 5 wikifurries edited Lord Blake
5: 5 wikifurries edited Antropomorfos
6: 5 wikifurries edited Beeps
7: 5 wikifurries edited Encyclopædia Dramatica
8: 4 wikifurries edited The Furry Den
9: 4 wikifurries edited Taris Quickpaw
10: 4 wikifurries edited DiFFur
11: 4 wikifurries edited Ruska
12: 4 wikifurries edited Lyosha Moonheart
13: 4 wikifurries edited Gals Gone Wild!
14: 4 wikifurries edited Jing
15: 4 wikifurries edited Hedon
16: 4 wikifurries edited Candice Vixen
17: 4 wikifurries edited Furs on Fire
18: 4 wikifurries edited Nyxx
19: 4 wikifurries edited Worldroleplay
20: 4 wikifurries edited Artem Rose
21: 4 wikifurries edited Teito
22: 4 wikifurries edited Oviposition
23: 4 wikifurries edited American Dad!
24: 4 wikifurries edited KnotCast
25: 4 wikifurries edited Ginger Vixen

fev 2009

1: 9 wikifurries edited Furp
2: 5 wikifurries edited Furry News (Russia)
3: 4 wikifurries edited Me-Me
4: 4 wikifurries edited Sypress
5: 4 wikifurries edited Bobskunk
6: 4 wikifurries edited Xkcd
7: 4 wikifurries edited List of in-person furry conventions by attendance
8: 4 wikifurries edited Furry Fiesta
9: 3 wikifurries edited FIGNUTS!
10: 3 wikifurries edited FIGNUTS
11: 3 wikifurries edited Akume
12: 3 wikifurries edited Roccie
13: 3 wikifurries edited Momiji-kun
14: 3 wikifurries edited Tigris Euphrates
15: 3 wikifurries edited Espsarleox
16: 3 wikifurries edited Scotiacon
17: 3 wikifurries edited Doa Ashwood
18: 3 wikifurries edited Howler
19: 3 wikifurries edited Taurus Beresford
20: 3 wikifurries edited BunbunMcCheffington
21: 3 wikifurries edited Taris Quickpaw
22: 3 wikifurries edited Qase
23: 3 wikifurries edited Aimore
24: 3 wikifurries edited Further Confusion 2009
25: 3 wikifurries edited Furry Network (news)

mar 2009

1: 6 wikifurries edited TigerTails Radio
2: 6 wikifurries edited Frank Gembeck
3: 5 wikifurries edited Lupine Assassin
4: 5 wikifurries edited Fursuit
5: 4 wikifurries edited Holydrake
6: 4 wikifurries edited Gritz Greasepup
7: 4 wikifurries edited Zorro Re
8: 4 wikifurries edited Anakuro
9: 4 wikifurries edited L.Z.Z. Littlething
10: 4 wikifurries edited Furfag
11: 4 wikifurries edited Babyfur
12: 4 wikifurries edited Fur Affinity
13: 3 wikifurries edited Zuri (artist)
14: 3 wikifurries edited Crusader Cat
15: 3 wikifurries edited Fox (disambiguation)
16: 3 wikifurries edited Blazerwolf
17: 3 wikifurries edited Arrowroot
18: 3 wikifurries edited Tavi Munk
19: 3 wikifurries edited Bakedfurs
20: 3 wikifurries edited Qba
21: 3 wikifurries edited Sanctuary: A Tale of Life in the Woods
22: 3 wikifurries edited Dog of Heaven
23: 3 wikifurries edited Indrora
24: 3 wikifurries edited Life's Dream
25: 3 wikifurries edited Black Gazza Prison

abr 2009

1: 8 wikifurries edited TigerTails Radio
2: 7 wikifurries edited Fandom's Favorite Fursuit Fracas 2009
3: 4 wikifurries edited Blyzzarde
4: 4 wikifurries edited Snowfox
5: 4 wikifurries edited Mort
6: 4 wikifurries edited Sirkillme
7: 4 wikifurries edited Veeku
8: 4 wikifurries edited Cid Silverwing
9: 3 wikifurries edited Crusader Cat
10: 3 wikifurries edited Bazz
11: 3 wikifurries edited MaxCoyote
12: 3 wikifurries edited UKfur2
13: 3 wikifurries edited Evertide
14: 3 wikifurries edited EvilSquirrel
15: 3 wikifurries edited Super Furry Animals (Sugar)
16: 3 wikifurries edited Cosfurs
17: 3 wikifurries edited Mercae Killar
18: 3 wikifurries edited Cachette Fox
19: 3 wikifurries edited Furp
20: 3 wikifurries edited Art-n-Coffee
21: 3 wikifurries edited Anakuro
22: 3 wikifurries edited RBW 2009
23: 3 wikifurries edited CreatureS
24: 3 wikifurries edited Daelyhel Axon
25: 3 wikifurries edited Mhisani

mai 2009

1: 8 wikifurries edited FurNation
2: 5 wikifurries edited Alan T. Panda
3: 4 wikifurries edited Keith Nightclaw
4: 4 wikifurries edited Tundra Fox
5: 4 wikifurries edited Knight Wolf
6: 4 wikifurries edited Toxic Tails
7: 4 wikifurries edited List of Ursa Major Awards winners
8: 4 wikifurries edited Kittenkeiko
9: 4 wikifurries edited Mephit Fur Meet X
10: 4 wikifurries edited YiffyToys (name dispute)
11: 4 wikifurries edited Guest
12: 3 wikifurries edited WildCritters
13: 3 wikifurries edited North American Red Hyena
14: 3 wikifurries edited Snowisterix Coldwhistler
15: 3 wikifurries edited Drak Wilde
16: 3 wikifurries edited Rule 34
17: 3 wikifurries edited History of FurNation
18: 3 wikifurries edited Virgil Rocca
19: 3 wikifurries edited In Between
20: 3 wikifurries edited Anthrogasm Magazine
21: 3 wikifurries edited Fox Tales Times
22: 3 wikifurries edited Teddy Foxcoon
23: 3 wikifurries edited Bloodfox
24: 3 wikifurries edited Frisbee
25: 3 wikifurries edited Fandom's Favorite Fursuit Fracas 2009

jun 2009

1: 6 wikifurries edited Alan T. Panda
2: 6 wikifurries edited Natasha Softpaw
3: 5 wikifurries edited BritFur Clubhouse
4: 5 wikifurries edited YiffChat
5: 4 wikifurries edited Lunestar Aesther
6: 4 wikifurries edited Tora NightProwler
7: 4 wikifurries edited Fandom's Favorite Fursuit Fracas 2009
8: 4 wikifurries edited TORA
9: 4 wikifurries edited Cid Silverwing
10: 4 wikifurries edited MILFurs
11: 4 wikifurries edited List of in-person furry conventions by attendance
12: 4 wikifurries edited Badly Drawn Kitties
13: 4 wikifurries edited Furry code
14: 4 wikifurries edited Otherkin
15: 4 wikifurries edited List of furry LiveJournal communities
16: 4 wikifurries edited Califur
17: 3 wikifurries edited Crusader Cat
18: 3 wikifurries edited Madagascar (characters, penguins)
19: 3 wikifurries edited Vore Code
20: 3 wikifurries edited Char (fursuiter)
21: 3 wikifurries edited OscarWolf
22: 3 wikifurries edited Dejitaru Ookami
23: 3 wikifurries edited WillowFox
24: 3 wikifurries edited KE Films
25: 3 wikifurries edited Iksar

jul 2009

1: 6 wikifurries edited TigerTails Radio
2: 6 wikifurries edited Anthrocon 2009
3: 5 wikifurries edited Buca di Beppo Con
4: 5 wikifurries edited Furfag
5: 5 wikifurries edited List of in-person furry conventions by attendance
6: 4 wikifurries edited Shane the Raccoon-Dog
7: 4 wikifurries edited Kova
8: 4 wikifurries edited The Penguins of Madagascar
9: 4 wikifurries edited Fandom's Favorite Fursuit Fracas 2009
10: 4 wikifurries edited Tipp
11: 4 wikifurries edited Sexual orientation
12: 4 wikifurries edited Furverts (art archive)
13: 4 wikifurries edited Softpaw Magazine
14: 4 wikifurries edited AOD Enigma
15: 4 wikifurries edited Beeps
16: 4 wikifurries edited Anti-furries
17: 3 wikifurries edited Anthrocon 2010
18: 3 wikifurries edited Andrew (writer)
19: 3 wikifurries edited Kitt Creations
20: 3 wikifurries edited Nuclear Paws
21: 3 wikifurries edited Hypnosis
22: 3 wikifurries edited Fearless Four
23: 3 wikifurries edited Mina Kitsune
24: 3 wikifurries edited West Virginia Furs
25: 3 wikifurries edited Mikune Folf

ago 2009

1: 8 wikifurries edited Furry fandom
2: 5 wikifurries edited Anakuro
3: 5 wikifurries edited TigerTails Radio
4: 5 wikifurries edited Fursuit
5: 4 wikifurries edited Mongrels
6: 4 wikifurries edited What The Fur
7: 4 wikifurries edited Second Life
8: 4 wikifurries edited Mozdoc
9: 4 wikifurries edited Furfag
10: 4 wikifurries edited Nazi Furs
11: 4 wikifurries edited Encyclopædia Dramatica
12: 3 wikifurries edited Roma Violet
13: 3 wikifurries edited IndyFurCon
14: 3 wikifurries edited Pornography (comic)
15: 3 wikifurries edited Bytown Furry Convention
16: 3 wikifurries edited Madagascar (characters, penguins)
17: 3 wikifurries edited Fandom's Favorite Fursuit Fracas 2009
18: 3 wikifurries edited CrocPond
19: 3 wikifurries edited History of Fur Affinity
20: 3 wikifurries edited The Goddamned Furry Board
21: 3 wikifurries edited Doxy
22: 3 wikifurries edited Anonymous (group)
23: 3 wikifurries edited Wolf roleplay forums
24: 3 wikifurries edited Dean Dodrill
25: 3 wikifurries edited Gathering of the Gargoyles

set 2009

1: 12 wikifurries edited Crusader Cat
2: 8 wikifurries edited Chew Fox
3: 8 wikifurries edited TORA
4: 6 wikifurries edited Eurofurence 15
5: 6 wikifurries edited Eurofurence
6: 5 wikifurries edited YouTube Furry War
7: 5 wikifurries edited List of in-person furry conventions by attendance
8: 4 wikifurries edited Schism H. Swiftpaw
9: 4 wikifurries edited RainFurrest 2009
10: 4 wikifurries edited Michael Hirtes
11: 3 wikifurries edited Thomas Lux
12: 3 wikifurries edited FOX-mas
13: 3 wikifurries edited Stripes Tiger
14: 3 wikifurries edited Foxwolf
15: 3 wikifurries edited Eurofurence 16
16: 3 wikifurries edited Golden Leaves Con
17: 3 wikifurries edited Furryempire
18: 3 wikifurries edited Zakk Jigsaw
19: 3 wikifurries edited Lupestripe
20: 3 wikifurries edited Tyroon Blackfire
21: 3 wikifurries edited History of Fur Affinity
22: 3 wikifurries edited Furry (EsperNet IRC)
23: 3 wikifurries edited Mozdoc
24: 3 wikifurries edited Further Confusion 2008
25: 3 wikifurries edited Alberta Furry Community

out 2009

1: 6 wikifurries edited FOXmas
2: 4 wikifurries edited Cakecon
3: 4 wikifurries edited G-GLITCH
4: 4 wikifurries edited Furry 4 Life
5: 3 wikifurries edited Esuterure
6: 3 wikifurries edited Dark B-Da (characters, main)
7: 3 wikifurries edited B-Daron (characters, secondary)
8: 3 wikifurries edited List of B-Daron characters
9: 3 wikifurries edited Koty
10: 3 wikifurries edited AuroraBorealia
11: 3 wikifurries edited Wintersnowolf
12: 3 wikifurries edited Raiettei
13: 3 wikifurries edited Lowlow64
14: 3 wikifurries edited Kuro the Wolf
15: 3 wikifurries edited Bursting
16: 3 wikifurries edited Lyude
17: 3 wikifurries edited Ookami Shichiyou
18: 3 wikifurries edited Ember
19: 3 wikifurries edited B-Daron
20: 3 wikifurries edited Timeline of media coverage
21: 3 wikifurries edited The Frozen Oasis
22: 3 wikifurries edited .fur
23: 3 wikifurries edited Popping
24: 3 wikifurries edited Extinctioners
25: 3 wikifurries edited Noelani Manawolf

nov 2009

1: 4 wikifurries edited Dragoneer
2: 4 wikifurries edited Anti-furries
3: 3 wikifurries edited Forest of Less Lust
4: 3 wikifurries edited NakamaCon
5: 3 wikifurries edited Abby-Fennec
6: 3 wikifurries edited PolarLight
7: 3 wikifurries edited Aurora Fox
8: 3 wikifurries edited Serengeti (Second Life)
9: 3 wikifurries edited Fauna Urbana
10: 3 wikifurries edited Iscin
11: 3 wikifurries edited HungaryFox
12: 3 wikifurries edited Chibirisu
13: 3 wikifurries edited Wolfee Darkfang
14: 3 wikifurries edited RBW 2009
15: 3 wikifurries edited Midwest FurFest 2010
16: 3 wikifurries edited Straitfox
17: 3 wikifurries edited Alin Raven
18: 3 wikifurries edited Farore Nightclaw
19: 3 wikifurries edited List of in-person furry conventions by attendance
20: 3 wikifurries edited Midwest FurFest
21: 2 wikifurries edited David Zawitaj
22: 2 wikifurries edited Hiro
23: 2 wikifurries edited Ashalind
24: 2 wikifurries edited Myra Midnight
25: 2 wikifurries edited Working con

dez 2009

1: 7 wikifurries edited History of Fur Affinity
2: 6 wikifurries edited Yiffstar
3: 5 wikifurries edited SoFurry
4: 4 wikifurries edited Nezukiba
5: 4 wikifurries edited Wantholf
6: 4 wikifurries edited History of FurNation
7: 4 wikifurries edited Brown Wantholf
8: 4 wikifurries edited
9: 4 wikifurries edited Wolfie (artist)
10: 3 wikifurries edited Perthfur Gathering
11: 3 wikifurries edited Suhoj VanBloodwolf
12: 3 wikifurries edited WereHusky (person)
13: 3 wikifurries edited Rose Hexwit
14: 3 wikifurries edited Dogslug
15: 3 wikifurries edited Sky Pyran
16: 3 wikifurries edited Cruel Jones
17: 3 wikifurries edited Furry Outpost
18: 3 wikifurries edited Spicey Feline
19: 3 wikifurries edited 2, The Ranting Gryphon
20: 3 wikifurries edited Timeline of media coverage
21: 3 wikifurries edited Fur Affinity
22: 2 wikifurries edited Lochnessmonstor0727
23: 2 wikifurries edited 1000 Ways to Die
24: 2 wikifurries edited DungeonPlace FetishCast
25: 2 wikifurries edited Danskunk

jan 2010

1: 4 wikifurries edited MiDFur
2: 4 wikifurries edited Anthrochat
3: 3 wikifurries edited Further Confusion 2011
4: 3 wikifurries edited Bastett
5: 3 wikifurries edited Sam \"AngelFox\" Hodgson
6: 3 wikifurries edited Azoth Zsun
7: 3 wikifurries edited Stone Forest
8: 3 wikifurries edited Kaworu
9: 3 wikifurries edited Steve the Tasmanian Devil
10: 3 wikifurries edited Foxen B. Perry
11: 3 wikifurries edited IndyFurCon
12: 3 wikifurries edited BC Furry Community Board
13: 3 wikifurries edited Alex Kovas
14: 3 wikifurries edited Furry News (Russia)
15: 3 wikifurries edited Further Confusion 2010
16: 3 wikifurries edited Rev Fox
17: 3 wikifurries edited Further Confusion 2009
18: 3 wikifurries edited Fandom's Favorite Fursuit Fracas
19: 3 wikifurries edited Mozdoc
20: 3 wikifurries edited New Year's Furry Ball
21: 3 wikifurries edited Evil Sibe
22: 3 wikifurries edited Timeline of media coverage
23: 3 wikifurries edited Jaspian
24: 3 wikifurries edited Frosty Orca
25: 3 wikifurries edited List of in-person furry conventions by attendance

fev 2010

1: 6 wikifurries edited FurDU
2: 5 wikifurries edited Connor Goodwolf
3: 5 wikifurries edited Dale Dalmatian
4: 5 wikifurries edited List of in-person furry conventions by attendance
5: 4 wikifurries edited Furry subreddit
6: 4 wikifurries edited Mozdoc
7: 4 wikifurries edited RivFur
8: 4 wikifurries edited Ristin
9: 4 wikifurries edited Furry Fiesta
10: 4 wikifurries edited High Tail Hall
11: 4 wikifurries edited Babyfur
12: 3 wikifurries edited Sero (Red Fox)
13: 3 wikifurries edited Bobby Thornbody
14: 3 wikifurries edited BrightEyes
15: 3 wikifurries edited Ubuntu Furry Remix
16: 3 wikifurries edited WillowRib
17: 3 wikifurries edited Muushi
18: 3 wikifurries edited TerrorBite
19: 3 wikifurries edited Furtastic
20: 3 wikifurries edited Furry Fiesta 2010
21: 3 wikifurries edited Furp
22: 3 wikifurries edited Topher the Tiger
23: 3 wikifurries edited Dogmeat
24: 3 wikifurries edited FlameDrake
25: 3 wikifurries edited Timeline of media coverage

mar 2010

1: 6 wikifurries edited Wolfee Darkfang
2: 5 wikifurries edited Michael Bard
3: 5 wikifurries edited List of in-person furry conventions by attendance
4: 5 wikifurries edited Michael Hirtes
5: 4 wikifurries edited Shiroko Nezumi
6: 4 wikifurries edited
7: 4 wikifurries edited Farallon Otter
8: 4 wikifurries edited Summer Furry Conference
9: 4 wikifurries edited Nuum
10: 4 wikifurries edited Furnal Equinox 2010
11: 4 wikifurries edited WikiFur
12: 4 wikifurries edited Vagabundo
13: 3 wikifurries edited Wild Zoo
14: 3 wikifurries edited Smokescale
15: 3 wikifurries edited Foxcoon
16: 3 wikifurries edited Taggz
17: 3 wikifurries edited Daniel Necros
18: 3 wikifurries edited Graan Forcii
19: 3 wikifurries edited KatrinaTheLamia
20: 3 wikifurries edited Jato
21: 3 wikifurries edited Antheria
22: 3 wikifurries edited Foxen B. Perry
23: 3 wikifurries edited Jarak
24: 3 wikifurries edited Roadside Romeo
25: 3 wikifurries edited TORA

abr 2010

1: 6 wikifurries edited Fandom's Favorite Fursuit Fracas 2010
2: 5 wikifurries edited PafCon (CSI)
3: 4 wikifurries edited Cmd246
4: 4 wikifurries edited Sean renard
5: 4 wikifurries edited Lil Chi Wolf
6: 4 wikifurries edited PAFCon
7: 4 wikifurries edited Lord Blake
8: 4 wikifurries edited Dan Skunk
9: 4 wikifurries edited YouTube Furry War
10: 3 wikifurries edited J.C. Roberts
11: 3 wikifurries edited Efenrai
12: 3 wikifurries edited J.D Gapczynski
13: 3 wikifurries edited Cassandra Rising
14: 3 wikifurries edited Watchtail
15: 3 wikifurries edited Save the Day
16: 3 wikifurries edited Andrew
17: 3 wikifurries edited Spazzeh
18: 3 wikifurries edited Izzy Featherbrain
19: 3 wikifurries edited Daniel A. Skirtandzy
20: 3 wikifurries edited Daliwolf
21: 3 wikifurries edited Robert W. Armstrong
22: 3 wikifurries edited FurbleFox
23: 2 wikifurries edited Sgt. Andrews
24: 2 wikifurries edited A Story of the Stone Age
25: 2 wikifurries edited Zimmimaru

mai 2010

1: 8 wikifurries edited Lupine Assassin
2: 6 wikifurries edited Higher Than the Stars
3: 5 wikifurries edited Taxidermy
4: 5 wikifurries edited Watchtail
5: 4 wikifurries edited Klaus Wolfsmann
6: 4 wikifurries edited List of in-person furry conventions by attendance
7: 3 wikifurries edited Central Midwest Furmeet
8: 3 wikifurries edited Fuzzy (wolf)
9: 3 wikifurries edited Shadsu
10: 3 wikifurries edited Clinical lycanthropy
11: 3 wikifurries edited Furnal Equinox
12: 3 wikifurries edited Suiraqua
13: 3 wikifurries edited IndyFurCon
14: 3 wikifurries edited Lili Fox
15: 3 wikifurries edited Ginkaze
16: 3 wikifurries edited ConFuzzled 2010
17: 3 wikifurries edited ShinAkira
18: 3 wikifurries edited Fargo Divine
19: 3 wikifurries edited Blazger
20: 3 wikifurries edited Something Awful
21: 2 wikifurries edited Babs Bunny (person)
22: 2 wikifurries edited Sebastian (fursuiter)
23: 2 wikifurries edited Sohjin
24: 2 wikifurries edited Fayd
25: 2 wikifurries edited Anna Lisica Fyodorova

jun 2010

1: 5 wikifurries edited Raifox
2: 4 wikifurries edited Nican
3: 4 wikifurries edited Muushi
4: 4 wikifurries edited Housepets!
5: 4 wikifurries edited Nephilim
6: 4 wikifurries edited Timeline of media coverage
7: 4 wikifurries edited FA: United
8: 3 wikifurries edited Golden Zoltan
9: 3 wikifurries edited Freya Fox
10: 3 wikifurries edited Kayote
11: 3 wikifurries edited Fideel
12: 3 wikifurries edited Mirelmture
13: 3 wikifurries edited Tenacious
14: 3 wikifurries edited Toklan Umia
15: 3 wikifurries edited TeneBear
16: 3 wikifurries edited Lupine Assassin
17: 3 wikifurries edited Furry
18: 3 wikifurries edited \"Furry\"ness
19: 3 wikifurries edited Vor-Com
20: 3 wikifurries edited White Wolf
21: 3 wikifurries edited Omaha The Cat Dancer
22: 3 wikifurries edited Ozy and Millie
23: 3 wikifurries edited Fur Affinity
24: 2 wikifurries edited SharpieSabre
25: 2 wikifurries edited Anthrocon 2010

jul 2010

1: 17 wikifurries edited Jessica Elwood
2: 6 wikifurries edited Furnal Equinox
3: 6 wikifurries edited Dan Skunk
4: 5 wikifurries edited Fur Affinity
5: 4 wikifurries edited BootedFurs
6: 4 wikifurries edited The Goddamned Furry Board
7: 3 wikifurries edited Therian (person)
8: 3 wikifurries edited Toronto Furries
9: 3 wikifurries edited Hikaru Wolf
10: 3 wikifurries edited Radio Unifurse
11: 3 wikifurries edited Xizana
12: 3 wikifurries edited Neko Neko
13: 3 wikifurries edited
14: 3 wikifurries edited International Yiff Center
15: 3 wikifurries edited Cody Denton
16: 3 wikifurries edited Targon
17: 3 wikifurries edited
18: 3 wikifurries edited Amanda Lillianne Drasciir
19: 3 wikifurries edited Foshu
20: 3 wikifurries edited Natasha Softpaw
21: 3 wikifurries edited Housepets!
22: 3 wikifurries edited Softpaw Magazine
23: 3 wikifurries edited Mishi
24: 3 wikifurries edited Gay Yiffy Club
25: 3 wikifurries edited Timeline of media coverage

ago 2010

1: 8 wikifurries edited Jessica Elwood
2: 5 wikifurries edited E621
3: 4 wikifurries edited South Bay FurBQ
4: 4 wikifurries edited Shapeshifting
5: 4 wikifurries edited List of furry LiveJournal communities
6: 3 wikifurries edited DevilynRave
7: 3 wikifurries edited Just Another Web Comic
8: 3 wikifurries edited Wolke
9: 3 wikifurries edited Kenai Wolf
10: 3 wikifurries edited BetaPaws Airbrushing
11: 3 wikifurries edited Anim
12: 3 wikifurries edited Flacko
13: 3 wikifurries edited Foxeh
14: 3 wikifurries edited Victor Whitepaw
15: 3 wikifurries edited Arrugusk WWolfe
16: 3 wikifurries edited TheCurryMouse
17: 3 wikifurries edited Sio
18: 3 wikifurries edited Lion21
19: 3 wikifurries edited Affy
20: 3 wikifurries edited International Yiff Center
21: 3 wikifurries edited Skin Deep
22: 3 wikifurries edited Furnal Equinox
23: 3 wikifurries edited KE Films
24: 3 wikifurries edited Keith Nightclaw
25: 3 wikifurries edited The Goddamned Furry Board

set 2010

1: 5 wikifurries edited Tuqiri
2: 4 wikifurries edited Comparison of furry art sites
3: 4 wikifurries edited Canadian Furries
4: 4 wikifurries edited Kyetsu
5: 4 wikifurries edited Connor Goodwolf
6: 4 wikifurries edited Eurofurence 16
7: 3 wikifurries edited DoPE Show 11
8: 3 wikifurries edited Gay Furry Club
9: 3 wikifurries edited Derek Paws
10: 3 wikifurries edited Ludicrousy
11: 3 wikifurries edited Bi-Snow
12: 3 wikifurries edited Kax Bloodwolf
13: 3 wikifurries edited REDnico
14: 3 wikifurries edited Iscin
15: 3 wikifurries edited StupidGit
16: 3 wikifurries edited Abe Groter
17: 3 wikifurries edited List of in-person furry conventions by attendance
18: 2 wikifurries edited Pendzez Zazkex
19: 2 wikifurries edited Horsefur32
20: 2 wikifurries edited Danny Dingo
21: 2 wikifurries edited Rai Inuzuma
22: 2 wikifurries edited Yena Dingo
23: 2 wikifurries edited Furantics
24: 2 wikifurries edited Jack Shade
25: 2 wikifurries edited MikasiWolf

out 2010

1: 4 wikifurries edited IMVU
2: 3 wikifurries edited JaxHusky
3: 3 wikifurries edited Freckle
4: 3 wikifurries edited Kovu DaLion
5: 3 wikifurries edited Valdyr Nordvindr
6: 3 wikifurries edited Dracolicoi
7: 3 wikifurries edited Garuru
8: 3 wikifurries edited Starblade Enkai
9: 3 wikifurries edited Johannes Wulfe
10: 3 wikifurries edited Furango
11: 3 wikifurries edited Tripp X Foxx
12: 3 wikifurries edited Madbadger
13: 3 wikifurries edited Mad Badger
14: 3 wikifurries edited Yena Dingo
15: 3 wikifurries edited Concession
16: 3 wikifurries edited FurNation
17: 2 wikifurries edited Maitre Joker
18: 2 wikifurries edited Kitty Komic
19: 2 wikifurries edited Sujiewolf
20: 2 wikifurries edited Squire
21: 2 wikifurries edited FennéCat
22: 2 wikifurries edited BraveStarr
23: 2 wikifurries edited Plot of Furthia High
24: 2 wikifurries edited Wolf Heart
25: 2 wikifurries edited Stephanie de la Loba Negra

nov 2010

1: 5 wikifurries edited Santasia
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Tsai Wolf
4: 4 wikifurries edited Stormytiggy
5: 3 wikifurries edited Equivamp
6: 3 wikifurries edited JaxHusky
7: 3 wikifurries edited Snoopy-pup
8: 3 wikifurries edited J' Wolf
9: 3 wikifurries edited J wolf
10: 3 wikifurries edited Jadar Wolf
11: 3 wikifurries edited Aka
12: 3 wikifurries edited Oklacon 2011
13: 3 wikifurries edited Scotiacon
14: 3 wikifurries edited History of Fur Affinity
15: 3 wikifurries edited Xalelydo Nightstride
16: 3 wikifurries edited K'sharra
17: 3 wikifurries edited Rahne Kallon
18: 3 wikifurries edited Midwest FurFest
19: 3 wikifurries edited Furry fandom
20: 3 wikifurries edited GreenReaper
21: 2 wikifurries edited Katiki Summerwind
22: 2 wikifurries edited Wolf Comix
23: 2 wikifurries edited Spiffy
24: 2 wikifurries edited Cyberbear
25: 2 wikifurries edited 2000s

dez 2010

1: 5 wikifurries edited Dracofoxy
2: 4 wikifurries edited Duamutef
3: 4 wikifurries edited The Deadly Wolves
4: 4 wikifurries edited YouTube Furry War
5: 4 wikifurries edited Timeline of media coverage
6: 3 wikifurries edited JaxHusky
7: 3 wikifurries edited Koroshi
8: 3 wikifurries edited Worgen
9: 3 wikifurries edited Shadowfox8588
10: 3 wikifurries edited Yiff This!
11: 3 wikifurries edited Steve the Tasmanian Devil
12: 3 wikifurries edited Miranda Leigh
13: 3 wikifurries edited History of Fur Affinity
14: 3 wikifurries edited Renamon
15: 3 wikifurries edited Fleshy
16: 2 wikifurries edited Lizaruk
17: 2 wikifurries edited Silvermane the Lion
18: 2 wikifurries edited Kaigan Kurone
19: 2 wikifurries edited Dai Lightfox
20: 2 wikifurries edited PuertoRican Furs
21: 2 wikifurries edited BlackStatic
22: 2 wikifurries edited Niveus
23: 2 wikifurries edited Megaverse
24: 2 wikifurries edited Cheddar Raccoon
25: 2 wikifurries edited Albino-Kitsune

jan 2011

1: 6 wikifurries edited Connor Goodwolf
2: 5 wikifurries edited Ixchel
3: 5 wikifurries edited Fur Affinity
4: 4 wikifurries edited GingerM
5: 4 wikifurries edited Evana Love
6: 3 wikifurries edited Furry Fashion
7: 3 wikifurries edited Tonite
8: 3 wikifurries edited Furry News Network
9: 3 wikifurries edited JaxHusky
10: 3 wikifurries edited AK
11: 3 wikifurries edited Leopard Radio — A Spotty Sound
12: 3 wikifurries edited QueFur
13: 3 wikifurries edited Further Confusion 2011
14: 3 wikifurries edited FrancoFur
15: 3 wikifurries edited Ultimate Furry Survey 2
16: 3 wikifurries edited Sketch Dalmatian
17: 3 wikifurries edited Furball Run
18: 3 wikifurries edited Lixa
19: 3 wikifurries edited New Year's Furry Ball
20: 3 wikifurries edited List of in-person furry conventions by attendance
21: 3 wikifurries edited List of furry LiveJournal communities
22: 3 wikifurries edited
23: 2 wikifurries edited Webcomic
24: 2 wikifurries edited AmyFoxx
25: 2 wikifurries edited TigerPillow

fev 2011

1: 5 wikifurries edited Snowpocalypse
2: 5 wikifurries edited F-list
3: 5 wikifurries edited JarekoJosh
4: 5 wikifurries edited Khaz (writer)
5: 4 wikifurries edited TD666
6: 4 wikifurries edited Connor Goodwolf
7: 4 wikifurries edited List of furry Facebook groups
8: 4 wikifurries edited Timeline of media coverage
9: 3 wikifurries edited Kurizu
10: 3 wikifurries edited TrueSero
11: 3 wikifurries edited Iruto
12: 3 wikifurries edited Skye Wilde
13: 3 wikifurries edited Kandi
14: 3 wikifurries edited Tzel Koskinen
15: 3 wikifurries edited Zidonuke
16: 3 wikifurries edited Lost Furest Creatures
17: 3 wikifurries edited Southernmost Furs
18: 3 wikifurries edited Babysitting Cream
19: 3 wikifurries edited Furry Fashion
20: 3 wikifurries edited Morin Wolf
21: 3 wikifurries edited Koro (person)
22: 3 wikifurries edited Nephilim
23: 3 wikifurries edited List of in-person furry conventions by attendance
24: 3 wikifurries edited Dragoneer
25: 3 wikifurries edited Burned Furs

mar 2011

1: 7 wikifurries edited Shadowfox8588
2: 6 wikifurries edited Shade DaWolf
3: 5 wikifurries edited Loki (Canada)
4: 5 wikifurries edited Fursuit
5: 4 wikifurries edited FinFur Summer Camp
6: 4 wikifurries edited Err0r-Keat0n
7: 4 wikifurries edited List of furry Facebook groups
8: 4 wikifurries edited Furry
9: 3 wikifurries edited Paradox (Canada)
10: 3 wikifurries edited Drayygon Skynoadar
11: 3 wikifurries edited Theosphir
12: 3 wikifurries edited Kato Yamamoto
13: 3 wikifurries edited Glaciercat
14: 3 wikifurries edited Gulf Coast Furs
15: 3 wikifurries edited Culpeo Fox
16: 3 wikifurries edited Istanbul
17: 3 wikifurries edited NakamaCon
18: 3 wikifurries edited Drittauge
19: 3 wikifurries edited FrancoFur
20: 3 wikifurries edited Rikoshi Kisaragi
21: 3 wikifurries edited List of conventions by theme
22: 3 wikifurries edited Banrai
23: 3 wikifurries edited Rabbit
24: 2 wikifurries edited Vincent Hayes
25: 2 wikifurries edited Equivamp

abr 2011

1: 6 wikifurries edited Zidonuke
2: 4 wikifurries edited Draak
3: 4 wikifurries edited Fritter
4: 4 wikifurries edited ZodiaCon
5: 4 wikifurries edited Dracofoxy
6: 4 wikifurries edited What The Fur
7: 4 wikifurries edited Evil Sibe
8: 4 wikifurries edited Encyclopædia Dramatica
9: 4 wikifurries edited Rocket City FurMeet
10: 3 wikifurries edited Equivamp
11: 3 wikifurries edited Servadile
12: 3 wikifurries edited Rocko Wolfcoon
13: 3 wikifurries edited Sen Grisane
14: 3 wikifurries edited Zandor
15: 3 wikifurries edited Photon
16: 3 wikifurries edited Fandom's Favorite Fursuit Fracas 2011
17: 3 wikifurries edited Twitter
18: 3 wikifurries edited Furlaxation
19: 3 wikifurries edited Loki (Canada)
20: 3 wikifurries edited JaxHusky
21: 3 wikifurries edited Kori Collie
22: 3 wikifurries edited Furry Canada Day
23: 3 wikifurries edited FurDU
24: 3 wikifurries edited Antheria
25: 3 wikifurries edited Golden Leaves Con

mai 2011

1: 6 wikifurries edited Quote
2: 5 wikifurries edited Ginger Vixen
3: 4 wikifurries edited Vago Kathyr Drachenwulf
4: 4 wikifurries edited Furries & Dyresex
5: 4 wikifurries edited Max & Ruby
6: 4 wikifurries edited Lola Bunny
7: 4 wikifurries edited Blarion
8: 4 wikifurries edited Twitter
9: 4 wikifurries edited Fritter
10: 4 wikifurries edited ConFuzzled 2011
11: 4 wikifurries edited Sparkledog
12: 4 wikifurries edited Pink Panther
13: 4 wikifurries edited List of in-person furry conventions by attendance
14: 4 wikifurries edited RainRat
15: 4 wikifurries edited Babyfur
16: 3 wikifurries edited Equivamp
17: 3 wikifurries edited Sapphy
18: 3 wikifurries edited Blindsight
19: 3 wikifurries edited Arctic Lion
20: 3 wikifurries edited Panda Jenn
21: 3 wikifurries edited XCM
22: 3 wikifurries edited Mustangwill
23: 3 wikifurries edited Kristofur
24: 3 wikifurries edited Xerxes Ayaphane
25: 3 wikifurries edited ConFuzzled 2012

jun 2011

1: 7 wikifurries edited Encyclopædia Dramatica
2: 5 wikifurries edited Equivamp
3: 4 wikifurries edited Chakat Blackspots
4: 4 wikifurries edited Horlequism
5: 4 wikifurries edited
6: 4 wikifurries edited Rocket City FurMeet 2011
7: 4 wikifurries edited Anthrocon 2011
8: 3 wikifurries edited Bobkitty
9: 3 wikifurries edited Encyclopædia Dramatica (.es)
10: 3 wikifurries edited Jhusky
11: 3 wikifurries edited Lolpard
12: 3 wikifurries edited NepEc
13: 3 wikifurries edited The Anthrocon Recruiting Song
14: 3 wikifurries edited Bagheera (character)
15: 3 wikifurries edited Azao
16: 3 wikifurries edited Setno
17: 3 wikifurries edited SunShadow
18: 3 wikifurries edited Kansans Improving Furry Fandom
19: 3 wikifurries edited Ami Darkfield
20: 3 wikifurries edited Tasmanian Devil
21: 3 wikifurries edited Furdance UK
22: 3 wikifurries edited Tillikum
23: 3 wikifurries edited Jaga Grey Fox
24: 3 wikifurries edited Ultimate Furry Survey 2
25: 3 wikifurries edited SmackJackal

jul 2011

1: 9 wikifurries edited Utah Furries
2: 6 wikifurries edited Dinosaur
3: 5 wikifurries edited Encyclopædia Dramatica (.es)
4: 5 wikifurries edited Darkdoomer
5: 4 wikifurries edited Kirara Munashi'i
6: 4 wikifurries edited Merfolk
7: 4 wikifurries edited Frogela
8: 4 wikifurries edited Rippy van Winkle
9: 4 wikifurries edited Rolf Raccoon
10: 4 wikifurries edited LondonFurs
11: 4 wikifurries edited Furry art
12: 4 wikifurries edited Monoceros
13: 4 wikifurries edited Tugrik
14: 3 wikifurries edited Carrot Wolf
15: 3 wikifurries edited Silverfoxwolf
16: 3 wikifurries edited Donkey (disambiguation)
17: 3 wikifurries edited Almost Naked Animals
18: 3 wikifurries edited Donkey
19: 3 wikifurries edited Zanobi
20: 3 wikifurries edited Drykus
21: 3 wikifurries edited Dolphyn
22: 3 wikifurries edited Spinfox
23: 3 wikifurries edited OMG Pineapples
24: 3 wikifurries edited Elastifur
25: 3 wikifurries edited Benji Squirrel

ago 2011

1: 6 wikifurries edited BiOzZ
2: 6 wikifurries edited Furnal Equinox
3: 5 wikifurries edited My Little Pony: Friendship is Magic
4: 5 wikifurries edited Eurofurence 17
5: 5 wikifurries edited List of in-person furry conventions by attendance
6: 4 wikifurries edited Nisse
7: 4 wikifurries edited Equivamp
8: 4 wikifurries edited FurryJadeFox
9: 4 wikifurries edited Brony
10: 4 wikifurries edited Encyclopædia Dramatica (.es)
11: 4 wikifurries edited Buddy
12: 4 wikifurries edited Christine Weston Chandler
13: 4 wikifurries edited International Yiff Center
14: 4 wikifurries edited Dan Skunk
15: 4 wikifurries edited Lynxcat
16: 4 wikifurries edited Furry Jews
17: 4 wikifurries edited Nazi Furs
18: 4 wikifurries edited Furry fandom
19: 3 wikifurries edited Ravinose Xue
20: 3 wikifurries edited Gizgiz
21: 3 wikifurries edited
22: 3 wikifurries edited FlurrBudgerigar
23: 3 wikifurries edited Buduse
24: 3 wikifurries edited Rymew
25: 3 wikifurries edited Camash Red

set 2011

1: 7 wikifurries edited Ozy and Millie
2: 5 wikifurries edited Fritter
3: 5 wikifurries edited Furnal Equinox
4: 5 wikifurries edited Poetigress
5: 5 wikifurries edited List of in-person furry conventions by attendance
6: 4 wikifurries edited WhiteCreature
7: 4 wikifurries edited FuRio
8: 4 wikifurries edited Equivamp
9: 4 wikifurries edited Gizgiz
10: 4 wikifurries edited Roma Violet
11: 4 wikifurries edited Furry
12: 4 wikifurries edited Kooshmeister
13: 4 wikifurries edited Brian O'Connell
14: 3 wikifurries edited Zuri (artist)
15: 3 wikifurries edited Yujoben
16: 3 wikifurries edited RooChi Lexico
17: 3 wikifurries edited Thay Rustback
18: 3 wikifurries edited WolfChildRusk
19: 3 wikifurries edited Lin-Shaddy
20: 3 wikifurries edited GerMANshep
21: 3 wikifurries edited LadyRoseWolf
22: 3 wikifurries edited Caenish
23: 3 wikifurries edited Irish furs
24: 3 wikifurries edited Allykai
25: 3 wikifurries edited

out 2011

1: 7 wikifurries edited Findra
2: 5 wikifurries edited Furry Avalon
3: 5 wikifurries edited Facebook
4: 4 wikifurries edited Vris
5: 4 wikifurries edited Snack Raccoon
6: 4 wikifurries edited Thea
7: 4 wikifurries edited Andy Dingo Wolf
8: 4 wikifurries edited Timbehr
9: 4 wikifurries edited Max the Wolf
10: 4 wikifurries edited JaseWolf Wylie
11: 4 wikifurries edited Gay Furry Club
12: 4 wikifurries edited Slinking Ferret
13: 3 wikifurries edited BMR777
14: 3 wikifurries edited JasperClaw
15: 3 wikifurries edited Monsieur Pingouin
16: 3 wikifurries edited HaxorFox
17: 3 wikifurries edited Spike
18: 3 wikifurries edited Nameless Traveler
19: 3 wikifurries edited Lucy Steam
20: 3 wikifurries edited Gina Hyena
21: 3 wikifurries edited Jimun
22: 3 wikifurries edited PunkTiger
23: 3 wikifurries edited Perthfurs
24: 3 wikifurries edited Sonious
25: 3 wikifurries edited Achlys

nov 2011

1: 5 wikifurries edited Cueball
2: 4 wikifurries edited Midwest FurFest 2012
3: 4 wikifurries edited My Little Pony: Friendship is Magic
4: 4 wikifurries edited Darkdoomer
5: 3 wikifurries edited Digitalpotato
6: 3 wikifurries edited Keelie (species)
7: 3 wikifurries edited FurIdaho
8: 3 wikifurries edited Durante Honovi Protettore
9: 3 wikifurries edited Nezumi Murasaki
10: 3 wikifurries edited Gerrark
11: 3 wikifurries edited Konaro
12: 3 wikifurries edited Ryan Wolf
13: 3 wikifurries edited Wolfix Vara
14: 3 wikifurries edited Skye Frostpaw
15: 3 wikifurries edited Kota tiger
16: 3 wikifurries edited Furry Friends
17: 3 wikifurries edited Cerberus de Rozier
18: 3 wikifurries edited Onyx Forepaw
19: 3 wikifurries edited Caryas
20: 3 wikifurries edited FurFright 2011
21: 3 wikifurries edited Dreaming
22: 3 wikifurries edited Midwest FurFest 2011
23: 3 wikifurries edited Gay Furry Club
24: 3 wikifurries edited FurCast
25: 3 wikifurries edited Friday Night Tracks

dez 2011

1: 6 wikifurries edited AuraSoul
2: 4 wikifurries edited Lem Ahnayd
3: 4 wikifurries edited F3 Convention
4: 4 wikifurries edited ChocolateKitsune
5: 4 wikifurries edited Tempe O'Kun
6: 3 wikifurries edited Skia
7: 3 wikifurries edited Kemospo
8: 3 wikifurries edited Therian Discovery Forum
9: 3 wikifurries edited Sylver
10: 3 wikifurries edited Mw
11: 3 wikifurries edited Opus Toruk-Maktoyu
12: 3 wikifurries edited Gao Ryu Polaris
13: 3 wikifurries edited Auric Dragon
14: 3 wikifurries edited Roderick The Rhodesian Ridgeback
15: 3 wikifurries edited AumoeLooure
16: 3 wikifurries edited The Yiff Gallery
17: 3 wikifurries edited Aroo Breastentein
18: 3 wikifurries edited Junius Arrakis
19: 3 wikifurries edited DinosaurDammit
20: 3 wikifurries edited Brown Leopard
21: 3 wikifurries edited Elphias Knightengale
22: 3 wikifurries edited Halfshell Hero
23: 3 wikifurries edited Timeline of media coverage
24: 3 wikifurries edited Genesis Whitmore
25: 3 wikifurries edited Anthrocon

jan 2012

1: 5 wikifurries edited Timmy Fox
2: 4 wikifurries edited Gabrielle Alexandria
3: 4 wikifurries edited Zodiac (comic)
4: 4 wikifurries edited Naughty Boys Lounge
5: 4 wikifurries edited Abbey Junction
6: 4 wikifurries edited Jack (webcomic)
7: 3 wikifurries edited Elmer (comics)
8: 3 wikifurries edited Trystan Seven
9: 3 wikifurries edited FastCat
10: 3 wikifurries edited Arcais
11: 3 wikifurries edited Wolfy Wet Furr
12: 3 wikifurries edited Ramas
13: 3 wikifurries edited Wraith (Zodiac)
14: 3 wikifurries edited Slaver
15: 3 wikifurries edited Saurus
16: 3 wikifurries edited Igneous
17: 3 wikifurries edited Hell Hound
18: 3 wikifurries edited Adolf Fockes
19: 3 wikifurries edited SpencerDragon
20: 3 wikifurries edited Chīsana-hi
21: 3 wikifurries edited Karn Thunderhoof
22: 3 wikifurries edited 2Fox
23: 3 wikifurries edited Savannah
24: 3 wikifurries edited Fox (disambiguation)
25: 3 wikifurries edited Bad Dragon

fev 2012

1: 4 wikifurries edited Shadow D Wolf
2: 4 wikifurries edited Kalza
3: 4 wikifurries edited SableQueanVilaya
4: 4 wikifurries edited Ceowolf
5: 4 wikifurries edited SilverAutomatic
6: 3 wikifurries edited Ten Types of Furry......
7: 3 wikifurries edited Poker Face
8: 3 wikifurries edited PREQUEL
9: 3 wikifurries edited Blastgoggles
10: 3 wikifurries edited Xenirk Bishop
11: 3 wikifurries edited Sciggles
12: 3 wikifurries edited Furs For Christ
13: 3 wikifurries edited Frolic
14: 3 wikifurries edited Mentova
15: 3 wikifurries edited Durante Honovi Protettore
16: 3 wikifurries edited Rusty Shark
17: 3 wikifurries edited Shadowfox8588
18: 3 wikifurries edited Sam Toxx
19: 3 wikifurries edited Bishop
20: 3 wikifurries edited Brown Leopard
21: 3 wikifurries edited Pixiv
22: 3 wikifurries edited Speeddog
23: 3 wikifurries edited Mandewo
24: 3 wikifurries edited Roudy Raccoon
25: 3 wikifurries edited HAJiME

mar 2012

1: 8 wikifurries edited Loki Blackfang
2: 6 wikifurries edited Encyclopædia Dramatica (.es)
3: 5 wikifurries edited Oddy
4: 5 wikifurries edited Surgat
5: 5 wikifurries edited Vivian Fox
6: 5 wikifurries edited FurIdaho
7: 5 wikifurries edited Babysitting Cream
8: 4 wikifurries edited TastesLikeAnya
9: 4 wikifurries edited SSJ3Mewtwo
10: 4 wikifurries edited Bazeel
11: 4 wikifurries edited Furensics Studios
12: 4 wikifurries edited Bradly
13: 4 wikifurries edited SableQueanVilaya
14: 4 wikifurries edited Lord Blake
15: 3 wikifurries edited TedSul Manor
16: 3 wikifurries edited USBlackWolf
17: 3 wikifurries edited RIMokINA
18: 3 wikifurries edited Nikoshi
19: 3 wikifurries edited Yak (person)
20: 3 wikifurries edited Fursuit dance
21: 3 wikifurries edited SaphireBlueflame
22: 3 wikifurries edited Sugarboy
23: 3 wikifurries edited Marfo
24: 3 wikifurries edited Nacht Krallen
25: 3 wikifurries edited Katikut

abr 2012

1: 6 wikifurries edited Onyx Forepaw
2: 5 wikifurries edited Arle
3: 4 wikifurries edited RottenCanines
4: 4 wikifurries edited Jabberwockychamber
5: 4 wikifurries edited Curly Fride
6: 4 wikifurries edited Ponysona
7: 4 wikifurries edited Weasyl
8: 4 wikifurries edited My Little Pony: Friendship is Magic
9: 4 wikifurries edited Timeline of media coverage
10: 3 wikifurries edited Ocean City Doo Dah Parade
11: 3 wikifurries edited ReggaeCyp
12: 3 wikifurries edited MasterLeo
13: 3 wikifurries edited Otter Starclaw
14: 3 wikifurries edited Foxamoore
15: 3 wikifurries edited DashBoom
16: 3 wikifurries edited Sapphwolf
17: 3 wikifurries edited Lyserc
18: 3 wikifurries edited JosePaw
19: 3 wikifurries edited TheDoggyGal
20: 3 wikifurries edited TearsOfFallenAngels
21: 3 wikifurries edited Cosplay
22: 3 wikifurries edited Niko Banks
23: 3 wikifurries edited Luthien Nightwolf
24: 3 wikifurries edited FurMedia
25: 3 wikifurries edited Wolfrun

mai 2012

1: 5 wikifurries edited Haku (person)
2: 5 wikifurries edited Watch Your Step
3: 4 wikifurries edited ConFuzzled 2012
4: 4 wikifurries edited
5: 3 wikifurries edited Maitre Joker
6: 3 wikifurries edited Aysel Blackpaws
7: 3 wikifurries edited Sval
8: 3 wikifurries edited Midnite MountainWulf
9: 3 wikifurries edited Fennec Helix
10: 3 wikifurries edited Foxen Halðorsòn
11: 3 wikifurries edited Jonas Corgi
12: 3 wikifurries edited Fauxwulf
13: 3 wikifurries edited Brex
14: 3 wikifurries edited Central Brisbane Furmeet
15: 3 wikifurries edited Innuk
16: 3 wikifurries edited Silverfoxwolf
17: 3 wikifurries edited Grubbs Grizzly
18: 3 wikifurries edited Ante Flan
19: 3 wikifurries edited Alin Raven
20: 3 wikifurries edited Drakien
21: 3 wikifurries edited Fjordwolf
22: 3 wikifurries edited Character
23: 2 wikifurries edited Drawolf
24: 2 wikifurries edited Etheras
25: 2 wikifurries edited Lychee

jun 2012

1: 4 wikifurries edited Alizar Kazam
2: 4 wikifurries edited Mark Shark
3: 4 wikifurries edited Impressive Title
4: 4 wikifurries edited Tigris The Lynx
5: 4 wikifurries edited Felixpath
6: 3 wikifurries edited Central Plains Fur Meet
7: 3 wikifurries edited Kage Kitsune
8: 3 wikifurries edited Wolfenfury
9: 3 wikifurries edited Shiron91
10: 3 wikifurries edited FurMedia
11: 3 wikifurries edited PrincessWolfgirl
12: 3 wikifurries edited NewEinstein
13: 3 wikifurries edited Quote
14: 3 wikifurries edited Resisting Arrest
15: 3 wikifurries edited Watch Your Step
16: 3 wikifurries edited Klaus Wolfsmann
17: 3 wikifurries edited Mavra
18: 3 wikifurries edited Anthrocon 2012
19: 3 wikifurries edited BlindWolf8
20: 3 wikifurries edited Twokinds
21: 3 wikifurries edited Postfurry
22: 3 wikifurries edited Forum
23: 3 wikifurries edited Mephit Furmeet
24: 3 wikifurries edited Fur Affinity
25: 3 wikifurries edited Jack (webcomic)

jul 2012

1: 5 wikifurries edited Mystery Otter
2: 4 wikifurries edited RedNeckFur
3: 4 wikifurries edited Seb the Shire
4: 4 wikifurries edited Kihari
5: 4 wikifurries edited Weasyl
6: 4 wikifurries edited Draconicus
7: 3 wikifurries edited WagzTail
8: 3 wikifurries edited Chay FuzzDingo
9: 3 wikifurries edited Enya Dyre
10: 3 wikifurries edited Eevachu
11: 3 wikifurries edited Indigo Yartsev
12: 3 wikifurries edited Taw Echo
13: 3 wikifurries edited Trey Haas
14: 3 wikifurries edited Fur-Eh!
15: 3 wikifurries edited FurryUnited
16: 3 wikifurries edited FuzzWolf
17: 3 wikifurries edited List of furry convention resources
18: 3 wikifurries edited Ink
19: 3 wikifurries edited Arcturus
20: 2 wikifurries edited Kellic Tiger
21: 2 wikifurries edited Shrike
22: 2 wikifurries edited CrescoTheEko
23: 2 wikifurries edited Amroth
24: 2 wikifurries edited Elden
25: 2 wikifurries edited Stagolopolis

ago 2012

1: 5 wikifurries edited Mystery Otter
2: 4 wikifurries edited Jaydom
3: 4 wikifurries edited Weasyl
4: 3 wikifurries edited Kot
5: 3 wikifurries edited Woofstep
6: 3 wikifurries edited Tomias
7: 3 wikifurries edited Furry Weekend Holland
8: 3 wikifurries edited SableQueanVilaya
9: 3 wikifurries edited F3 Convention
10: 3 wikifurries edited The Yiff Gallery
11: 3 wikifurries edited Scotiacon
12: 3 wikifurries edited Kipper Otter
13: 3 wikifurries edited List of in-person furry conventions by attendance
14: 3 wikifurries edited N
15: 3 wikifurries edited Fur Affinity
16: 2 wikifurries edited ScotiaCon 2011
17: 2 wikifurries edited Robert Marble
18: 2 wikifurries edited Alex Schlarmann
19: 2 wikifurries edited Tora
20: 2 wikifurries edited Maxy
21: 2 wikifurries edited Luther Vogt
22: 2 wikifurries edited Red Dane
23: 2 wikifurries edited What The Fur 2013
24: 2 wikifurries edited 3rd Rail Furrs
25: 2 wikifurries edited 757-Furries

set 2012

1: 4 wikifurries edited Delicious (image board)
2: 4 wikifurries edited Menebunny
3: 4 wikifurries edited Eurofurence 18
4: 3 wikifurries edited YIFF
5: 3 wikifurries edited Rhinoceros
6: 3 wikifurries edited Rin Wolfe
7: 3 wikifurries edited Ibercamp
8: 3 wikifurries edited -KronexFire-
9: 3 wikifurries edited Feral! 2012
10: 3 wikifurries edited Tenacious
11: 3 wikifurries edited Red XIII
12: 3 wikifurries edited FurJAM
13: 3 wikifurries edited Timeline of media coverage
14: 3 wikifurries edited S'A'Alis
15: 3 wikifurries edited Furry stereotype
16: 3 wikifurries edited Oklacon
17: 2 wikifurries edited Arkobear
18: 2 wikifurries edited Jade Bleufox
19: 2 wikifurries edited PyroTheFox
20: 2 wikifurries edited Ursidae
21: 2 wikifurries edited Oblivion Island: Haruka and the Magic Mirror
22: 2 wikifurries edited Polar Bear's Café
23: 2 wikifurries edited Wolfe Masters
24: 2 wikifurries edited Suneccubus
25: 2 wikifurries edited Feral! 2013

out 2012

1: 5 wikifurries edited Nightmare The Stallion
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 5 wikifurries edited Mitch Beiro
4: 4 wikifurries edited Faraj Fox
5: 4 wikifurries edited Fangcon
6: 3 wikifurries edited EcoVerse
7: 3 wikifurries edited Dame Fortune
8: 3 wikifurries edited Vinderex
9: 3 wikifurries edited Mystery Otter
10: 3 wikifurries edited Fenrirs Child
11: 3 wikifurries edited Bradly
12: 3 wikifurries edited Dracofoxy
13: 3 wikifurries edited Timeline of conventions by attendance
14: 3 wikifurries edited VancouFur
15: 3 wikifurries edited Fox (disambiguation)
16: 3 wikifurries edited Frankie Wolf
17: 3 wikifurries edited Rocket City FurMeet 2005
18: 3 wikifurries edited Ri'en Karrot
19: 3 wikifurries edited Feefers
20: 3 wikifurries edited Matrices
21: 3 wikifurries edited Tucson Mob
22: 3 wikifurries edited Vixen
23: 3 wikifurries edited Dorsai Irregulars
24: 2 wikifurries edited NightWolf714
25: 2 wikifurries edited Licorice

nov 2012

1: 6 wikifurries edited Benji Squirrel
2: 5 wikifurries edited Fuzzer Fox
3: 5 wikifurries edited Hoof Beat
4: 5 wikifurries edited Stalking Cat
5: 4 wikifurries edited Doctor Fox
6: 4 wikifurries edited Wolfrun
7: 4 wikifurries edited Badgerguy
8: 4 wikifurries edited Vulpin
9: 3 wikifurries edited Room 366
10: 3 wikifurries edited FurFright 2012
11: 3 wikifurries edited Mystery Otter
12: 3 wikifurries edited Tompson
13: 3 wikifurries edited PrincessWolfgirl
14: 3 wikifurries edited Yelth
15: 3 wikifurries edited Encyclopædia Dramatica (.es)
16: 3 wikifurries edited Quote
17: 3 wikifurries edited Rusty Haller
18: 3 wikifurries edited Furry Life Grid
19: 3 wikifurries edited Nanukk Luik
20: 3 wikifurries edited Fite!
21: 3 wikifurries edited Cliff Husky
22: 3 wikifurries edited Betsie Blossum
23: 3 wikifurries edited Convention shirt
24: 3 wikifurries edited Jim Hardiman
25: 3 wikifurries edited The Lion King

dez 2012

1: 5 wikifurries edited Furry Defence Force
2: 5 wikifurries edited Isaac M. Baranoff
3: 5 wikifurries edited FurPlanet
4: 4 wikifurries edited Fox Azure
5: 4 wikifurries edited MiDFur
6: 3 wikifurries edited Felix Ohlsson
7: 3 wikifurries edited FurWAG
8: 3 wikifurries edited Nya (Indiana)
9: 3 wikifurries edited Jett Ailchu McCulley
10: 3 wikifurries edited Wolfe Thane
11: 3 wikifurries edited Desolate Vorigan
12: 3 wikifurries edited Jaydom
13: 3 wikifurries edited Mystery Otter
14: 3 wikifurries edited Echo Ries
15: 3 wikifurries edited Rusticdragon20
16: 3 wikifurries edited Weasyl
17: 3 wikifurries edited PrincessWolfgirl
18: 3 wikifurries edited Red Lantern
19: 3 wikifurries edited Clan Rikier
20: 3 wikifurries edited Furlaxation
21: 3 wikifurries edited Mystic Studios Productions
22: 3 wikifurries edited Cruelty
23: 3 wikifurries edited Ballerina Mafia
24: 3 wikifurries edited MyFur Network
25: 3 wikifurries edited Christine Weston Chandler

jan 2013

1: 4 wikifurries edited Midnight Wolf
2: 4 wikifurries edited Further Confusion 2013
3: 4 wikifurries edited Furrydrama 2
4: 4 wikifurries edited KnifeH
5: 4 wikifurries edited Inari the Fox
6: 4 wikifurries edited Jess Hillard
7: 4 wikifurries edited List of furry IRC channels
8: 4 wikifurries edited Evo T Rex
9: 4 wikifurries edited Non-anthro
10: 3 wikifurries edited Lem Ahnayd
11: 3 wikifurries edited AnmieHaven
12: 3 wikifurries edited That Purple Fox
13: 3 wikifurries edited MattK1989
14: 3 wikifurries edited Tooth Less (person)
15: 3 wikifurries edited Thanshuhai
16: 3 wikifurries edited ConFurgence
17: 3 wikifurries edited Confurgence
18: 3 wikifurries edited American Furry Association
19: 3 wikifurries edited Nikki Foxxe
20: 3 wikifurries edited Shasta Wulftrax
21: 3 wikifurries edited Western Anthro Rendezvous
22: 3 wikifurries edited Faraj Fox
23: 3 wikifurries edited Midori (fursuiter)
24: 3 wikifurries edited Woofstep
25: 3 wikifurries edited Wuffles the Worgen

fev 2013

1: 4 wikifurries edited KentFurs
2: 4 wikifurries edited Dreamkix
3: 3 wikifurries edited Drachetto
4: 3 wikifurries edited Joshua Krimmel
5: 3 wikifurries edited Chunghwa Furry
6: 3 wikifurries edited Thanshuhai
7: 3 wikifurries edited Western Anthro Rendezvous
8: 3 wikifurries edited Room 366
9: 3 wikifurries edited NordicFuzzCon 2013
10: 3 wikifurries edited Vivian Fox
11: 3 wikifurries edited Furry Fiesta 2013
12: 3 wikifurries edited Skyfox
13: 3 wikifurries edited History of Fur Affinity
14: 3 wikifurries edited Shnell
15: 3 wikifurries edited DesertCat
16: 3 wikifurries edited Verdauga
17: 3 wikifurries edited FurPark
18: 3 wikifurries edited Brian Harp
19: 3 wikifurries edited Furry Fiesta
20: 3 wikifurries edited Pokémon
21: 3 wikifurries edited Rocky Mountain Fur Con
22: 3 wikifurries edited Mitch Beiro
23: 3 wikifurries edited Yiff
24: 2 wikifurries edited Naragon
25: 2 wikifurries edited Gummibear Kai

mar 2013

1: 6 wikifurries edited Benji Squirrel
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Sharako CloudCat
4: 4 wikifurries edited Harley Coyote (United States)
5: 4 wikifurries edited Sparky (UK)
6: 4 wikifurries edited The BeatleWolf
7: 4 wikifurries edited VancouFur
8: 3 wikifurries edited Foxelbox
9: 3 wikifurries edited Leilani Perriere
10: 3 wikifurries edited Voreo Sabrae
11: 3 wikifurries edited TigressStar
12: 3 wikifurries edited WildCritters
13: 3 wikifurries edited Aussie Panther
14: 3 wikifurries edited Kat Aclysm
15: 3 wikifurries edited Blix Fox
16: 3 wikifurries edited Malaika Mizaati
17: 3 wikifurries edited Khord Kitty
18: 3 wikifurries edited Victoria Loveless
19: 3 wikifurries edited Arizona Fur Con
20: 3 wikifurries edited Furnal Equinox 2013
21: 3 wikifurries edited JustifyMySanity
22: 3 wikifurries edited NordicFuzzCon 2013
23: 3 wikifurries edited The Confectionaries
24: 3 wikifurries edited Fur the 'More
25: 3 wikifurries edited Phil Adler

abr 2013

1: 8 wikifurries edited Fur the 'More
2: 5 wikifurries edited Tyciol
3: 5 wikifurries edited Junius Arrakis
4: 5 wikifurries edited Jack (webcomic)
5: 4 wikifurries edited Culpeo Wolf
6: 4 wikifurries edited Scrumpet
7: 4 wikifurries edited NordicFuzzCon 2013
8: 4 wikifurries edited Equivamp
9: 4 wikifurries edited Sparky (UK)
10: 4 wikifurries edited Liko
11: 4 wikifurries edited The Suburban Jungle
12: 4 wikifurries edited Babyfur
13: 3 wikifurries edited Charlie Strap and Froggy Ball
14: 3 wikifurries edited Charlie Strap and Froggy Ball Flying High
15: 3 wikifurries edited Kaeldu
16: 3 wikifurries edited ThaiAnthro
17: 3 wikifurries edited Nicholas Jasaitis
18: 3 wikifurries edited Furry Migration
19: 3 wikifurries edited J'adoube
20: 3 wikifurries edited Wereman
21: 3 wikifurries edited Milo Puppypaws
22: 3 wikifurries edited Lozbunneh
23: 3 wikifurries edited Maxwell Rodgers
24: 3 wikifurries edited Miltonius Prime
25: 3 wikifurries edited Furry Dakimakura

mai 2013

1: 6 wikifurries edited Biggest Little Fur Con 2013
2: 6 wikifurries edited Zidonuke
3: 5 wikifurries edited Furtastic
4: 4 wikifurries edited Honeymoon Omega Twilight
5: 4 wikifurries edited Kyle McCarthy
6: 4 wikifurries edited Lemonade Coyote
7: 4 wikifurries edited WUFF
8: 4 wikifurries edited AnthrOhio
9: 3 wikifurries edited Tannyn
10: 3 wikifurries edited Foxy Paws
11: 3 wikifurries edited Marie the Fox
12: 3 wikifurries edited Unigan Caravan
13: 3 wikifurries edited PokerWolf2
14: 3 wikifurries edited Furtastic 2
15: 3 wikifurries edited Furtastic 1
16: 3 wikifurries edited Gateway FurMeet
17: 3 wikifurries edited Krinn DNZ
18: 3 wikifurries edited Harley Coyote (United States)
19: 3 wikifurries edited Furlandia 2013
20: 3 wikifurries edited NordicFuzzCon 2013
21: 3 wikifurries edited Central Plains Fur Meet
22: 3 wikifurries edited Desucon
23: 3 wikifurries edited Brenda Banks
24: 3 wikifurries edited Mighty the Super Mouse
25: 3 wikifurries edited Onyx Forepaw

jun 2013

1: 5 wikifurries edited Micah Sheehan
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Furbraskon
4: 4 wikifurries edited Vivian Fox
5: 4 wikifurries edited Cliff Husky
6: 3 wikifurries edited Majira
7: 3 wikifurries edited Butters
8: 3 wikifurries edited Love ◦ Sex ◦ Fur
9: 3 wikifurries edited Axxis
10: 3 wikifurries edited Out Fox'd
11: 3 wikifurries edited Lunostophiles
12: 3 wikifurries edited Pareldraakje
13: 3 wikifurries edited Bookmarfs!
14: 3 wikifurries edited Angela Barefield
15: 3 wikifurries edited Cayne
16: 3 wikifurries edited Rancid
17: 3 wikifurries edited Avanto
18: 3 wikifurries edited Fisher Track
19: 3 wikifurries edited Amy Ninetails
20: 3 wikifurries edited Futerkon
21: 3 wikifurries edited Anthrocon 2016
22: 3 wikifurries edited Weasyl
23: 3 wikifurries edited Gdakon
24: 3 wikifurries edited Adjective species
25: 3 wikifurries edited Quincy the Raccoon

jul 2013

1: 4 wikifurries edited Khord Kitty
2: 3 wikifurries edited Furry Unlocked
3: 3 wikifurries edited Kwandry Baasher
4: 3 wikifurries edited Furs Venezuela
5: 3 wikifurries edited Fur Squared
6: 3 wikifurries edited Sibe
7: 3 wikifurries edited FurMedia
8: 3 wikifurries edited Fur the 'More
9: 3 wikifurries edited Kenson Shimobe
10: 3 wikifurries edited Fuchsia Possum
11: 3 wikifurries edited Dirtiran
12: 3 wikifurries edited FoxTailedCritter
13: 3 wikifurries edited Snowpocalypse
14: 3 wikifurries edited International Yiff Center
15: 3 wikifurries edited Jaga Grey Fox
16: 3 wikifurries edited Wuffsky
17: 3 wikifurries edited Kyoujin
18: 3 wikifurries edited FurJAM
19: 3 wikifurries edited Adjectivecat
20: 3 wikifurries edited Megaplex
21: 3 wikifurries edited Babyfur
22: 2 wikifurries edited Maitre Joker
23: 2 wikifurries edited MoogiMonster
24: 2 wikifurries edited Cyclone Fusky
25: 2 wikifurries edited Yinepu Sanctimonialis

ago 2013

1: 5 wikifurries edited Blarmajin
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Junius Arrakis
4: 4 wikifurries edited Rhazafax
5: 4 wikifurries edited Snoopy-pup
6: 3 wikifurries edited Kenai Tiger
7: 3 wikifurries edited Eternalskyy
8: 3 wikifurries edited Cef
9: 3 wikifurries edited Furry Unlocked
10: 3 wikifurries edited Fuzzweekend
11: 3 wikifurries edited Kium
12: 3 wikifurries edited Bradly
13: 3 wikifurries edited Campfire Tails
14: 3 wikifurries edited Connor Goodwolf
15: 3 wikifurries edited Cruel Jones
16: 3 wikifurries edited IndyFurCon
17: 3 wikifurries edited Crux (species)
18: 3 wikifurries edited Chrono Reaper
19: 3 wikifurries edited Shadster
20: 3 wikifurries edited Ratatouille
21: 3 wikifurries edited Headless lounge
22: 2 wikifurries edited SenkoLKE
23: 2 wikifurries edited Silverstreak Folf
24: 2 wikifurries edited Sasori Midoriyama
25: 2 wikifurries edited ScruffKerfluff

set 2013

1: 4 wikifurries edited Furry Connection North
2: 4 wikifurries edited Hyenafur
3: 4 wikifurries edited List of in-person furry conventions by attendance
4: 3 wikifurries edited Shanie
5: 3 wikifurries edited Megasong
6: 3 wikifurries edited Skrapz
7: 3 wikifurries edited Deer Boy!
8: 3 wikifurries edited Great Lakes Fur Con
9: 3 wikifurries edited Sovandie
10: 3 wikifurries edited Syan
11: 3 wikifurries edited Furbraskon
12: 3 wikifurries edited Furlandia 2013
13: 3 wikifurries edited Furlaxation
14: 3 wikifurries edited FurCast
15: 3 wikifurries edited Mikune Folf
16: 3 wikifurries edited Ryan Blackpaw
17: 3 wikifurries edited Robert W. Armstrong
18: 3 wikifurries edited Shadowpelt
19: 3 wikifurries edited MILFurs
20: 3 wikifurries edited ConFuzzled
21: 3 wikifurries edited Yosh!
22: 2 wikifurries edited Eirene Crimsonpelt
23: 2 wikifurries edited Saints Row IV
24: 2 wikifurries edited Jimmy Talon
25: 2 wikifurries edited SilverCherry

out 2013

1: 4 wikifurries edited Tent Con
2: 4 wikifurries edited Felix
3: 4 wikifurries edited Eirene Crimsonpelt
4: 3 wikifurries edited KCFur Howl
5: 3 wikifurries edited Swashbuckled
6: 3 wikifurries edited Project Zero
7: 3 wikifurries edited Phalanxfox
8: 3 wikifurries edited RainFurrest 2014
9: 3 wikifurries edited Rocky Mountain Fur Con 2014
10: 3 wikifurries edited Fur Reality
11: 3 wikifurries edited Toboe Coyote
12: 3 wikifurries edited Further Confusion 2014
13: 3 wikifurries edited Leiton Grey
14: 3 wikifurries edited Iara Warriorfeather
15: 3 wikifurries edited Oki Doki Coyote
16: 3 wikifurries edited Equivamp
17: 3 wikifurries edited Wile E. Coyote
18: 3 wikifurries edited Aaron8181
19: 3 wikifurries edited Abby-Fennec
20: 3 wikifurries edited The Katbox
21: 3 wikifurries edited Wild Bill TX
22: 3 wikifurries edited FurPlanet
23: 3 wikifurries edited RainFurrest
24: 3 wikifurries edited Bay Area Furry
25: 3 wikifurries edited Something Awful

nov 2013

1: 5 wikifurries edited Onyx Forepaw
2: 4 wikifurries edited List of fursuit dance competition results
3: 4 wikifurries edited Dredge Iceclaw
4: 4 wikifurries edited Kei Fox
5: 4 wikifurries edited Georgia Furs
6: 4 wikifurries edited List of in-person furry conventions by attendance
7: 4 wikifurries edited Foxy (UK)
8: 3 wikifurries edited YiFFr
9: 3 wikifurries edited Averious
10: 3 wikifurries edited FurrTrax
11: 3 wikifurries edited Silver Yote
12: 3 wikifurries edited Las Lindas bonus comics
13: 3 wikifurries edited That Blue Fox
14: 3 wikifurries edited Gateway FurMeet
15: 3 wikifurries edited Midwest FurFest 2013
16: 3 wikifurries edited The First Book of Lapism
17: 3 wikifurries edited Sabarika
18: 3 wikifurries edited Toby Bluth
19: 2 wikifurries edited Cosmic Dash
20: 2 wikifurries edited Ringer Racsky
21: 2 wikifurries edited Cyfur the Rat
22: 2 wikifurries edited The Drifter
23: 2 wikifurries edited Vertigo (DC Comics)
24: 2 wikifurries edited Diesel Winter
25: 2 wikifurries edited Keyla

dez 2013

1: 4 wikifurries edited Shanniecat
2: 4 wikifurries edited XDasXGoochX
3: 4 wikifurries edited Tuvalu
4: 4 wikifurries edited FurFright
5: 3 wikifurries edited Splinter Vulpes
6: 3 wikifurries edited Fur Isle
7: 3 wikifurries edited Gateway FurMeet
8: 3 wikifurries edited Nol
9: 3 wikifurries edited Furbraskon
10: 3 wikifurries edited Midwest FurFest 2013
11: 3 wikifurries edited Konaro
12: 3 wikifurries edited Dark
13: 3 wikifurries edited Owlie (artist)
14: 3 wikifurries edited Camp Furst State
15: 3 wikifurries edited Cheese Beagle
16: 3 wikifurries edited Antilia
17: 3 wikifurries edited Feral
18: 2 wikifurries edited Phoenixwolf33
19: 2 wikifurries edited Furryexperience
20: 2 wikifurries edited ZakDaRak
21: 2 wikifurries edited ČeSFuR 10
22: 2 wikifurries edited Nayel-ie
23: 2 wikifurries edited Jakob SciFox
24: 2 wikifurries edited RougeCottonCandy
25: 2 wikifurries edited Sparx Traxx

jan 2014

1: 4 wikifurries edited Onno Valent
2: 4 wikifurries edited Toffy Fennecat
3: 4 wikifurries edited Dodge The Wolf
4: 4 wikifurries edited Tegan Mint
5: 4 wikifurries edited
6: 4 wikifurries edited Zidonuke
7: 4 wikifurries edited List of in-person furry conventions by attendance
8: 4 wikifurries edited Fur Affinity
9: 4 wikifurries edited GreenReaper
10: 3 wikifurries edited Warren Arkell
11: 3 wikifurries edited Kayla-Na
12: 3 wikifurries edited Poppy Wusky
13: 3 wikifurries edited Little Paws Elementary School
14: 3 wikifurries edited Mahaska
15: 3 wikifurries edited Jeani
16: 3 wikifurries edited Corvus Pointer
17: 3 wikifurries edited Further Confusion 2014
18: 3 wikifurries edited Weasyl
19: 3 wikifurries edited Lucca
20: 3 wikifurries edited KekPafrany
21: 3 wikifurries edited Bobby Thornbody
22: 3 wikifurries edited Randy Darkshade
23: 3 wikifurries edited Ren Queenston
24: 3 wikifurries edited Hendikins
25: 3 wikifurries edited Marko the Rat

fev 2014

1: 4 wikifurries edited Kishma Danielle
2: 3 wikifurries edited Dalen Dyson
3: 3 wikifurries edited Tenmashi
4: 3 wikifurries edited Pebbles
5: 3 wikifurries edited Hunter DarkWolf
6: 3 wikifurries edited Nicholas Kruger
7: 3 wikifurries edited Fur Isle
8: 3 wikifurries edited Furry Migration
9: 3 wikifurries edited Foxxel Pobieski
10: 3 wikifurries edited Made Fur You
11: 3 wikifurries edited Ren Queenston
12: 3 wikifurries edited Snap E. Tiger
13: 3 wikifurries edited Ted Sheppard
14: 2 wikifurries edited Sheevee
15: 2 wikifurries edited Franz Kresnik Furlong
16: 2 wikifurries edited Ophia
17: 2 wikifurries edited Strawberry wolf girl
18: 2 wikifurries edited IndyFurry
19: 2 wikifurries edited Bloomingfurs
20: 2 wikifurries edited Galacticat
21: 2 wikifurries edited Animal House
22: 2 wikifurries edited The Maltese Fur-Con
23: 2 wikifurries edited Thistle
24: 2 wikifurries edited Deb Kosiba
25: 2 wikifurries edited Likely Shepherd

mar 2014

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Logn
3: 4 wikifurries edited Dalen Dyson
4: 4 wikifurries edited Sheba Metaluna
5: 4 wikifurries edited Ginger Wolfy
6: 3 wikifurries edited Taboo (anthology)
7: 3 wikifurries edited Catfx
8: 3 wikifurries edited Revolutionary Spark
9: 3 wikifurries edited Skandian Midori
10: 3 wikifurries edited AndyMcNub
11: 3 wikifurries edited Furluminati Fanzine
12: 3 wikifurries edited Replic TuaniOne
13: 3 wikifurries edited Sterling Fox
14: 3 wikifurries edited VancouFur 2013
15: 3 wikifurries edited Midnight Wolf
16: 3 wikifurries edited Felix Ohlsson
17: 3 wikifurries edited Zeta Syanthis
18: 3 wikifurries edited JadeyKayk
19: 3 wikifurries edited Kovu DaLion
20: 3 wikifurries edited Crusader Cat
21: 3 wikifurries edited Neubauje
22: 3 wikifurries edited Ren Queenston
23: 3 wikifurries edited Boomer The Dog
24: 3 wikifurries edited Illys
25: 2 wikifurries edited PopessLodovica

abr 2014

1: 6 wikifurries edited List of in-person furry conventions by attendance
2: 5 wikifurries edited ConFurgence
3: 4 wikifurries edited Motor City Furry Con
4: 3 wikifurries edited Smashwolf
5: 3 wikifurries edited UberQuest
6: 3 wikifurries edited Miles Hyena Sauber
7: 3 wikifurries edited Deeso
8: 3 wikifurries edited Catraxx
9: 3 wikifurries edited Oracle Sage
10: 3 wikifurries edited PopessLodovica
11: 3 wikifurries edited Furpocalypse
12: 3 wikifurries edited Antnommer
13: 3 wikifurries edited Fur Isle
14: 3 wikifurries edited Kaedal
15: 3 wikifurries edited Lightpaws
16: 3 wikifurries edited FurDU
17: 3 wikifurries edited Kimbo
18: 3 wikifurries edited FilthyRotten Jackalope
19: 3 wikifurries edited Bernard (animated series)
20: 3 wikifurries edited Korrok
21: 2 wikifurries edited River Street Fur Meet
22: 2 wikifurries edited Jason Turner
23: 2 wikifurries edited Surfur
24: 2 wikifurries edited Shenba LiveOak
25: 2 wikifurries edited Blaferis

mai 2014

1: 5 wikifurries edited Tag (magazine)
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Morphicon 2014
4: 4 wikifurries edited Devilwuff
5: 4 wikifurries edited Folwilliar
6: 4 wikifurries edited Telos
7: 3 wikifurries edited AnthroDex
8: 3 wikifurries edited Furry Latino
9: 3 wikifurries edited Raed Wulf
10: 3 wikifurries edited ConFuzzled 2014
11: 3 wikifurries edited Doctor Fox
12: 3 wikifurries edited Central Plains Fur Meet
13: 3 wikifurries edited Central Brisbane Furmeet
14: 3 wikifurries edited Kemonochan
15: 3 wikifurries edited WUFF
16: 3 wikifurries edited Yiffy International
17: 3 wikifurries edited
18: 3 wikifurries edited Tumbles the Stairdragon
19: 3 wikifurries edited Abando
20: 3 wikifurries edited Seel
21: 2 wikifurries edited Alessandro Bruno
22: 2 wikifurries edited The Karmadillo
23: 2 wikifurries edited MancFurs
24: 2 wikifurries edited Luca
25: 2 wikifurries edited Keero Firefly

jun 2014

1: 5 wikifurries edited Fursuit
2: 4 wikifurries edited Famvie
3: 4 wikifurries edited Zaria Melody
4: 4 wikifurries edited Fur Isle
5: 4 wikifurries edited Maxwell Rodgers
6: 4 wikifurries edited Bischop
7: 4 wikifurries edited Anthrocon 2014
8: 4 wikifurries edited Califur
9: 3 wikifurries edited Macro/Micro (panel)
10: 3 wikifurries edited R.C. Fox
11: 3 wikifurries edited Furryformer
12: 3 wikifurries edited FinFur Animus
13: 3 wikifurries edited Lee Yang-Il
14: 3 wikifurries edited Eurofurs
15: 3 wikifurries edited Yannarra Cheena
16: 3 wikifurries edited Kyle McCarthy
17: 3 wikifurries edited Kitutal
18: 3 wikifurries edited Geemo
19: 3 wikifurries edited Katherine Delany
20: 3 wikifurries edited Khaz (writer)
21: 3 wikifurries edited Betsy Beaver
22: 3 wikifurries edited Keiko (host)
23: 3 wikifurries edited List of in-person furry conventions by attendance
24: 3 wikifurries edited Clint Warlick
25: 2 wikifurries edited Maitre Joker

jul 2014

1: 5 wikifurries edited Lymril
2: 4 wikifurries edited Keershang
3: 4 wikifurries edited Hawker-Blue
4: 4 wikifurries edited Jason Blake
5: 4 wikifurries edited List of in-person furry conventions by attendance
6: 3 wikifurries edited Artica Sparkle
7: 3 wikifurries edited Bre Bleats
8: 3 wikifurries edited Squeak!
9: 3 wikifurries edited FurIronCity
10: 3 wikifurries edited Achilles Wolf
11: 3 wikifurries edited FURSTRE.AM
12: 3 wikifurries edited Critter Conquest
13: 3 wikifurries edited Alan Loewen
14: 3 wikifurries edited Fursuiter.NET
15: 3 wikifurries edited Bansdulf
16: 3 wikifurries edited Wulfer
17: 3 wikifurries edited Flexible Survival
18: 3 wikifurries edited AmyFoxx
19: 3 wikifurries edited SoftPaws
20: 2 wikifurries edited Senor Crouch
21: 2 wikifurries edited Kiba Snowpaw
22: 2 wikifurries edited SpaceCadet (artist)
23: 2 wikifurries edited FeatherSouls
24: 2 wikifurries edited Ermitis Oase
25: 2 wikifurries edited SnowKitty

ago 2014

1: 4 wikifurries edited Gelty Drake
2: 4 wikifurries edited Anti dev
3: 3 wikifurries edited DoPE Show 15
4: 3 wikifurries edited Naore Kitsurube
5: 3 wikifurries edited Prince Vaxis
6: 3 wikifurries edited Eurofurence 20
7: 3 wikifurries edited Azuura Husky
8: 3 wikifurries edited Falvie
9: 3 wikifurries edited Skyfire (Furtopia)
10: 3 wikifurries edited Equivamp
11: 3 wikifurries edited Endtown
12: 3 wikifurries edited Raven Welesa
13: 3 wikifurries edited Adult work
14: 3 wikifurries edited WikiFur
15: 3 wikifurries edited MILFurs
16: 3 wikifurries edited List of in-person furry conventions by attendance
17: 3 wikifurries edited Eurofurence
18: 2 wikifurries edited Xander Zzyzx
19: 2 wikifurries edited Apathy Kat
20: 2 wikifurries edited Ashtonoir
21: 2 wikifurries edited Jem Kegawa
22: 2 wikifurries edited Miranda Gusek
23: 2 wikifurries edited IdentiFUR
24: 2 wikifurries edited Eligecos
25: 2 wikifurries edited Vallhund

set 2014

1: 5 wikifurries edited Furry Migration
2: 5 wikifurries edited Jim Hardiman
3: 4 wikifurries edited Lucian the Otter
4: 4 wikifurries edited CrescoTheEko
5: 4 wikifurries edited FurJAM
6: 4 wikifurries edited Vorarephilia
7: 3 wikifurries edited KodaD.S
8: 3 wikifurries edited Theblackvixen
9: 3 wikifurries edited Rocoro
10: 3 wikifurries edited FurWanted
11: 3 wikifurries edited AIDS (comic)
12: 3 wikifurries edited Wolf-Bold
13: 3 wikifurries edited Darcus
14: 3 wikifurries edited Jayri Avieock
15: 3 wikifurries edited Gdakon
16: 3 wikifurries edited Horndog
17: 3 wikifurries edited Mikune Folf
18: 3 wikifurries edited Zen Fetcher
19: 3 wikifurries edited List of in-person furry conventions by attendance
20: 3 wikifurries edited Tom Verré
21: 2 wikifurries edited Werewolf Z
22: 2 wikifurries edited Nezumiro Harmonia
23: 2 wikifurries edited RainFurrest 2015
24: 2 wikifurries edited Bremen
25: 2 wikifurries edited Coby Wong

out 2014

1: 5 wikifurries edited FurGather
2: 5 wikifurries edited Schnookums
3: 4 wikifurries edited Fandom's Favorite Fursuit Fracas 2014
4: 3 wikifurries edited Edward Fuzzypaws
5: 3 wikifurries edited Tigerdile
6: 3 wikifurries edited Cyan Friskypaws
7: 3 wikifurries edited Brian Vermin
8: 3 wikifurries edited Wu Wei
9: 3 wikifurries edited Nezumiro Harmonia
10: 3 wikifurries edited Italian Fur Haven
11: 3 wikifurries edited Revolutionary Spark
12: 3 wikifurries edited FurrTrax
13: 3 wikifurries edited Shelsey Nijs
14: 3 wikifurries edited Foofox
15: 3 wikifurries edited History of Fur Affinity
16: 3 wikifurries edited Fangz (Norway)
17: 3 wikifurries edited Sarin Kilgare
18: 3 wikifurries edited MILFurs
19: 3 wikifurries edited Laini
20: 3 wikifurries edited Bob M. Guthrie
21: 2 wikifurries edited FurReal
22: 2 wikifurries edited Databendr
23: 2 wikifurries edited VampiricIce
24: 2 wikifurries edited Motley the wolf
25: 2 wikifurries edited Draco Lockhard

nov 2014

1: 4 wikifurries edited FurReal
2: 4 wikifurries edited Freya Fox
3: 4 wikifurries edited List of in-person furry conventions by attendance
4: 3 wikifurries edited Brian Vermin
5: 3 wikifurries edited PAWCon
6: 3 wikifurries edited Seth Vermin
7: 3 wikifurries edited Benji Squirrel
8: 3 wikifurries edited Dale
9: 3 wikifurries edited Ren Queenston
10: 3 wikifurries edited Blotch
11: 3 wikifurries edited Encyclopædia Dramatica
12: 3 wikifurries edited Max Black Rabbit
13: 2 wikifurries edited Wayfarer 1805
14: 2 wikifurries edited Room Party (game)
15: 2 wikifurries edited Flinke
16: 2 wikifurries edited Bandit
17: 2 wikifurries edited Enigma (Australia)
18: 2 wikifurries edited Enigma
19: 2 wikifurries edited Booby Tales
20: 2 wikifurries edited Leopold the Cat
21: 2 wikifurries edited Jovial
22: 2 wikifurries edited Pacific Anthropomorphics League
23: 2 wikifurries edited Chip and Dale
24: 2 wikifurries edited Chip 'n' Dale
25: 2 wikifurries edited DarkDragon563

dez 2014

1: 6 wikifurries edited Midwest FurFest 2014
2: 4 wikifurries edited Redlinelies
3: 4 wikifurries edited List of fursuit dance competition results
4: 4 wikifurries edited Julian Norwood
5: 3 wikifurries edited Azure Paragon
6: 3 wikifurries edited Doc (artist)
7: 3 wikifurries edited Painless Black Wolf
8: 3 wikifurries edited Wag (person)
9: 3 wikifurries edited Fur Isle
10: 3 wikifurries edited Sibe
11: 3 wikifurries edited Animal Boxing
12: 3 wikifurries edited Weasyl
13: 3 wikifurries edited My Little Pony: Friendship is Magic
14: 3 wikifurries edited FeralHeart
15: 3 wikifurries edited Soda
16: 3 wikifurries edited Grifter Timber Wolf
17: 3 wikifurries edited Evil Sibe
18: 3 wikifurries edited Jim Hardiman
19: 3 wikifurries edited Albedo Anthropomorphics
20: 3 wikifurries edited Midwest FurFest
21: 2 wikifurries edited Ame and Yuki: Wolf Children
22: 2 wikifurries edited Acid Mango
23: 2 wikifurries edited Fluffii Wolf
24: 2 wikifurries edited Ranek
25: 2 wikifurries edited Safyras

jan 2015

1: 3 wikifurries edited Grape Collie
2: 3 wikifurries edited TeaKitsune
3: 3 wikifurries edited Kamillex
4: 3 wikifurries edited Tokyo Jungle
5: 3 wikifurries edited Transphinx
6: 3 wikifurries edited Töntig Rotfuchs
7: 3 wikifurries edited Fluffy Waddles
8: 3 wikifurries edited Further Confusion 2015
9: 3 wikifurries edited Jade Bleufox
10: 3 wikifurries edited List of in-person furry conventions by attendance
11: 3 wikifurries edited Nazi Furs
12: 3 wikifurries edited Vixen Vending Machine
13: 3 wikifurries edited Meme
14: 2 wikifurries edited Taj
15: 2 wikifurries edited Imuhata
16: 2 wikifurries edited D-Claw
17: 2 wikifurries edited Iris Jay
18: 2 wikifurries edited Honey Bär
19: 2 wikifurries edited Aleksandra Petrovic
20: 2 wikifurries edited Oso Alex
21: 2 wikifurries edited Foxxin
22: 2 wikifurries edited Nasu The Red Wolf
23: 2 wikifurries edited ToxxiMoth
24: 2 wikifurries edited Alpha von Wolfstein
25: 2 wikifurries edited Pandaren

fev 2015

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 3 wikifurries edited Club Penguin
3: 3 wikifurries edited RUdragon
4: 3 wikifurries edited Hoot
5: 3 wikifurries edited List of furry convention resources
6: 3 wikifurries edited FoxMajik
7: 2 wikifurries edited Foxelbox
8: 2 wikifurries edited Zuzu
9: 2 wikifurries edited Nevrean
10: 2 wikifurries edited Lilith Sturlson
11: 2 wikifurries edited Klivord
12: 2 wikifurries edited AtlWolf
13: 2 wikifurries edited Flex the Border Collie
14: 2 wikifurries edited Will King
15: 2 wikifurries edited Terry Mouse
16: 2 wikifurries edited Twitch Eaglehart
17: 2 wikifurries edited Khaos, LLC
18: 2 wikifurries edited Fantagraphics Books
19: 2 wikifurries edited Zuri (artist)
20: 2 wikifurries edited Fur Isle
21: 2 wikifurries edited 2010s
22: 2 wikifurries edited Amodeo
23: 2 wikifurries edited ZodiaCon
24: 2 wikifurries edited Ticky Draconia
25: 2 wikifurries edited Skiltek

mar 2015

1: 7 wikifurries edited List of in-person furry conventions by attendance
2: 5 wikifurries edited Eevachu
3: 4 wikifurries edited Eagle God-Heart
4: 4 wikifurries edited Christian Fur
5: 3 wikifurries edited Brambles Lingren
6: 3 wikifurries edited Tokifuji
7: 3 wikifurries edited Aardwolf Essex
8: 3 wikifurries edited Motor City Furry Con
9: 3 wikifurries edited NordicFuzzCon
10: 3 wikifurries edited Fursephone
11: 3 wikifurries edited Popufur
12: 3 wikifurries edited Campfire Tails
13: 3 wikifurries edited Cheetah Kid
14: 3 wikifurries edited World of Warcraft
15: 3 wikifurries edited Akili Kota
16: 2 wikifurries edited Millie Gryphon
17: 2 wikifurries edited Renashe
18: 2 wikifurries edited Pizzazz Fennec
19: 2 wikifurries edited Gabriel Morgan
20: 2 wikifurries edited PalmarianFire
21: 2 wikifurries edited Top Dog
22: 2 wikifurries edited KEMONERS
23: 2 wikifurries edited Ratte
24: 2 wikifurries edited NotMeNotYou
25: 2 wikifurries edited Five Nights at Freddy's

abr 2015

1: 5 wikifurries edited Dickbitch Molly
2: 4 wikifurries edited Zinta Foxana
3: 4 wikifurries edited Purgy
4: 4 wikifurries edited Ferdinand Foxcoon
5: 4 wikifurries edited Philippine Anthro Festival
6: 4 wikifurries edited Eevachu
7: 3 wikifurries edited JrFur
8: 3 wikifurries edited GreekFurs
9: 3 wikifurries edited BSting
10: 3 wikifurries edited Marquis2007
11: 3 wikifurries edited TimScorpion
12: 3 wikifurries edited K.A. Monroe
13: 3 wikifurries edited Ruhrcon
14: 3 wikifurries edited Kemoket
15: 3 wikifurries edited Ino
16: 3 wikifurries edited StrawberryPawz
17: 3 wikifurries edited Conner Hemming
18: 3 wikifurries edited DarkCyberWolf
19: 3 wikifurries edited MacroFurry
20: 3 wikifurries edited ShadowConner
21: 3 wikifurries edited Alty
22: 3 wikifurries edited Wilford B. Wolf
23: 3 wikifurries edited Fursuit construction
24: 3 wikifurries edited The Deadly Wolves
25: 3 wikifurries edited Ren Queenston

mai 2015

1: 5 wikifurries edited AnthrOhio
2: 4 wikifurries edited Rai Shuan
3: 4 wikifurries edited Biggest Little Fur Con 2015
4: 4 wikifurries edited IMVU
5: 3 wikifurries edited Chucky
6: 3 wikifurries edited Someday We Will Leave this Town
7: 3 wikifurries edited FursonaCon
8: 3 wikifurries edited Atlantic Furries
9: 3 wikifurries edited Snowpaw
10: 3 wikifurries edited Taylor The Wolf
11: 3 wikifurries edited Furlandia
12: 3 wikifurries edited Maxwell Rodgers
13: 3 wikifurries edited Maxy
14: 3 wikifurries edited TheKarelia
15: 3 wikifurries edited Rattie TheRat
16: 3 wikifurries edited Mw
17: 3 wikifurries edited Steven R. Boyett
18: 3 wikifurries edited List of in-person furry conventions by attendance
19: 3 wikifurries edited Rat
20: 3 wikifurries edited Goldfur (chakat)
21: 2 wikifurries edited The White Fox
22: 2 wikifurries edited Slash Skunk
23: 2 wikifurries edited Derek Macrowolf
24: 2 wikifurries edited Furry Picnic
25: 2 wikifurries edited Ace Wolf

jun 2015

1: 8 wikifurries edited Kyle Lambert
2: 7 wikifurries edited Happy Feet
3: 6 wikifurries edited Kosperry
4: 5 wikifurries edited Ozzy Furocity
5: 4 wikifurries edited Zootopia
6: 4 wikifurries edited Toby-Wolfkat
7: 4 wikifurries edited InkedFur
8: 3 wikifurries edited The Rescuers
9: 3 wikifurries edited Doug
10: 3 wikifurries edited InsertPenname
11: 3 wikifurries edited SinghaTheLion
12: 3 wikifurries edited Sheppy Shep
13: 3 wikifurries edited Elttob
14: 3 wikifurries edited Shinopa Thyme
15: 3 wikifurries edited My Little Pony: Friendship is Magic
16: 3 wikifurries edited Fur Fighters
17: 3 wikifurries edited Garyu (Germany)
18: 3 wikifurries edited Anthony (artist)
19: 3 wikifurries edited Ocelot (species)
20: 3 wikifurries edited Hotel Yorba
21: 3 wikifurries edited Jim Hardiman
22: 3 wikifurries edited Doug Winger
23: 2 wikifurries edited Takuma Kitsune
24: 2 wikifurries edited Ocelot
25: 2 wikifurries edited Ainsley Evergarden

jul 2015

1: 4 wikifurries edited ShibaInYou
2: 4 wikifurries edited Red Savage
3: 4 wikifurries edited WindWolf
4: 4 wikifurries edited Khord Kitty
5: 4 wikifurries edited My Little Pony: Friendship is Magic
6: 4 wikifurries edited EAST
7: 4 wikifurries edited Jade Wolf
8: 3 wikifurries edited Lordferalina12
9: 3 wikifurries edited Ayala Deer
10: 3 wikifurries edited Squeeterbee
11: 3 wikifurries edited Arcturas Callahan
12: 3 wikifurries edited Ubertech
13: 3 wikifurries edited Project Nakti
14: 3 wikifurries edited Five Nights at Freddy's
15: 3 wikifurries edited Furiffic
16: 3 wikifurries edited Floyd (fursuiter)
17: 3 wikifurries edited Flexible Survival
18: 3 wikifurries edited Mursa ArtDragon
19: 3 wikifurries edited Evil Sibe
20: 3 wikifurries edited Chimera (modern hybrid)
21: 3 wikifurries edited 4chan
22: 3 wikifurries edited Anthrocon
23: 2 wikifurries edited LoliSwitch
24: 2 wikifurries edited Lady Kurai
25: 2 wikifurries edited Niro

ago 2015

1: 6 wikifurries edited My Little Pony: Friendship is Magic
2: 5 wikifurries edited Onzeno
3: 4 wikifurries edited Mpanthera
4: 3 wikifurries edited Sasha Tigress
5: 3 wikifurries edited Zorphbert and Fred
6: 3 wikifurries edited Ratteu
7: 3 wikifurries edited Hekytii
8: 3 wikifurries edited Kira Resari
9: 3 wikifurries edited Tony Crynight
10: 3 wikifurries edited Izzy Gamble
11: 3 wikifurries edited Beauty of the Bass
12: 3 wikifurries edited TimeSuppression
13: 3 wikifurries edited WindWolf
14: 3 wikifurries edited Foxwave Jawsy
15: 3 wikifurries edited List of fursuit dance competition results
16: 3 wikifurries edited Phil Adler
17: 3 wikifurries edited Stone Paws
18: 3 wikifurries edited List of in-person furry conventions by attendance
19: 3 wikifurries edited Kyle \"Kay\" Fox
20: 3 wikifurries edited Kurt Miller
21: 3 wikifurries edited Ken Pick
22: 3 wikifurries edited Furry stereotype
23: 3 wikifurries edited FurNation
24: 2 wikifurries edited Oh Joy Sex Toy
25: 2 wikifurries edited Katiki Summerwind

set 2015

1: 7 wikifurries edited ArosFair
2: 6 wikifurries edited LadyNightosphere
3: 6 wikifurries edited SharpieSabre
4: 4 wikifurries edited JoeCWolf
5: 4 wikifurries edited Obsydian
6: 4 wikifurries edited Legion (person)
7: 4 wikifurries edited List of in-person furry conventions by attendance
8: 3 wikifurries edited Vidwulf Spiritweaver
9: 3 wikifurries edited Five Nights at Freddy's
10: 3 wikifurries edited RainFurrest 2015
11: 3 wikifurries edited FAU 2015
12: 3 wikifurries edited List of fursuit dance competition results
13: 3 wikifurries edited Motor City Furry Con
14: 3 wikifurries edited Nevin Fox
15: 3 wikifurries edited Timmy Fox
16: 3 wikifurries edited Rye Bunny
17: 3 wikifurries edited Romeo & Juliet: Sealed With a Kiss
18: 2 wikifurries edited Maitre Joker
19: 2 wikifurries edited Columbia Basin Fur Con
20: 2 wikifurries edited An Anthropomorphic Century
21: 2 wikifurries edited Kurdan Sourpuss
22: 2 wikifurries edited Chero Pawfree
23: 2 wikifurries edited South Bank Fur Meet
24: 2 wikifurries edited Anisava
25: 2 wikifurries edited Owlette

out 2015

1: 6 wikifurries edited Ottawa Furs
2: 5 wikifurries edited Meet the Feebles
3: 4 wikifurries edited Sammy Chessy Husky
4: 4 wikifurries edited Fluffy Waddles
5: 4 wikifurries edited Tom Fischbach
6: 3 wikifurries edited X231
7: 3 wikifurries edited Blithwulf
8: 3 wikifurries edited Darkstalkers
9: 3 wikifurries edited Kurt Folf
10: 3 wikifurries edited Sangie Nativus
11: 3 wikifurries edited RainFurrest 2015
12: 3 wikifurries edited Motor City Furry Con
13: 3 wikifurries edited CrescoTheEko
14: 3 wikifurries edited PREQUEL
15: 3 wikifurries edited Bandit the Raccoon
16: 3 wikifurries edited Morenatsu
17: 3 wikifurries edited Sergal
18: 3 wikifurries edited RabidFox
19: 3 wikifurries edited Simba Lion (United States)
20: 3 wikifurries edited TygerMoon Foxx
21: 3 wikifurries edited Fur Affinity
22: 2 wikifurries edited Undertale
23: 2 wikifurries edited Milady Gevras
24: 2 wikifurries edited DLM X-13
25: 2 wikifurries edited R. C. Powell

nov 2015

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited AxleFusky
3: 4 wikifurries edited Jonesy Tawner
4: 3 wikifurries edited Fluffy Waddles
5: 3 wikifurries edited Kuperfox
6: 3 wikifurries edited Liz Stanford
7: 3 wikifurries edited Bryndle Sibe
8: 3 wikifurries edited MILFurs
9: 3 wikifurries edited List of most popular species
10: 2 wikifurries edited Undertale
11: 2 wikifurries edited Fursace
12: 2 wikifurries edited Vex
13: 2 wikifurries edited Bornes
14: 2 wikifurries edited Lareth Inuzuka
15: 2 wikifurries edited Makazi and Karibu
16: 2 wikifurries edited Licensable Bear™
17: 2 wikifurries edited Jaggy
18: 2 wikifurries edited Furry Network (art archive)
19: 2 wikifurries edited Michael Furia
20: 2 wikifurries edited Norwegian Dragonkin Gathering
21: 2 wikifurries edited Sleet (character)
22: 2 wikifurries edited Codywife1
23: 2 wikifurries edited Astral Wolf (New York)
24: 2 wikifurries edited Carrus
25: 2 wikifurries edited Jonathan Villarruel

dez 2015

1: 4 wikifurries edited Rick Griffin
2: 3 wikifurries edited Mirotic
3: 3 wikifurries edited Crusader Cat
4: 3 wikifurries edited United Space Force
5: 3 wikifurries edited Tex Avery
6: 2 wikifurries edited Furry Siesta
7: 2 wikifurries edited Axle
8: 2 wikifurries edited Cody Paul Brian
9: 2 wikifurries edited Furs Upon Malaysia
10: 2 wikifurries edited Tronchy
11: 2 wikifurries edited Cobalt le'Sieg
12: 2 wikifurries edited Philippine Anthro Festival 2015
13: 2 wikifurries edited Jerzy Drozd
14: 2 wikifurries edited Dasker Cicurel
15: 2 wikifurries edited Static Claws
16: 2 wikifurries edited AlpineHell
17: 2 wikifurries edited AxleFusky
18: 2 wikifurries edited Flex the Border Collie
19: 2 wikifurries edited Apple V
20: 2 wikifurries edited Midwest FurFest 2015
21: 2 wikifurries edited Banjo the Woodpile Cat
22: 2 wikifurries edited Rocoro
23: 2 wikifurries edited R.C. Fox
24: 2 wikifurries edited Ifus Moraine
25: 2 wikifurries edited Shiro Themian Ulv

jan 2016

1: 4 wikifurries edited Pixar
2: 3 wikifurries edited Undertale
3: 3 wikifurries edited AJ Shepherd
4: 3 wikifurries edited Suit-Up Saturday
5: 3 wikifurries edited The Angry Beavers
6: 3 wikifurries edited Bonk Batfox
7: 3 wikifurries edited 4lung
8: 3 wikifurries edited Kitsunerumai
9: 3 wikifurries edited Tronchy
10: 3 wikifurries edited List of fursuit dance competition results
11: 3 wikifurries edited Jasen Tamiia
12: 3 wikifurries edited Furfag
13: 3 wikifurries edited Furry Forum
14: 3 wikifurries edited Midwest FurFest
15: 2 wikifurries edited Cooper Sims
16: 2 wikifurries edited Kihu
17: 2 wikifurries edited Eaglebird
18: 2 wikifurries edited Sini
19: 2 wikifurries edited Carrizo Kitfox
20: 2 wikifurries edited Khaiger
21: 2 wikifurries edited Matt Sowers
22: 2 wikifurries edited The Bamaisin Family
23: 2 wikifurries edited NadiaWolf240
24: 2 wikifurries edited Silipin Starfox
25: 2 wikifurries edited Radywolf

fev 2016

1: 6 wikifurries edited Brasil FurFest
2: 5 wikifurries edited RainFurrest 2016
3: 5 wikifurries edited Kemono
4: 4 wikifurries edited Krystal Kitsune
5: 4 wikifurries edited RainFurrest
6: 3 wikifurries edited Animals. (television series)
7: 3 wikifurries edited Whitefire Nomura
8: 3 wikifurries edited Bones
9: 3 wikifurries edited Grape Collie
10: 3 wikifurries edited Yannarra Cheena
11: 3 wikifurries edited The Carmine Bordello
12: 3 wikifurries edited List of fursuit dance competition results
13: 3 wikifurries edited Mike Folf
14: 3 wikifurries edited Rokefox
15: 3 wikifurries edited SnappyWolf
16: 3 wikifurries edited List of in-person furry conventions by attendance
17: 2 wikifurries edited Kitty (artist)
18: 2 wikifurries edited K-LINE
19: 2 wikifurries edited Jace Zantetsukin
20: 2 wikifurries edited Xch3l
21: 2 wikifurries edited Fur Squared 2016
22: 2 wikifurries edited C.L. The Raccoon
23: 2 wikifurries edited Rachel (Minnesota)
24: 2 wikifurries edited Trybal Wolf
25: 2 wikifurries edited Kota Winter

mar 2016

1: 7 wikifurries edited Zootopia
2: 5 wikifurries edited SoftDiamond
3: 5 wikifurries edited Zootopia meets
4: 5 wikifurries edited Furry Siesta
5: 5 wikifurries edited Christine Weston Chandler
6: 4 wikifurries edited Brasil FurFest
7: 4 wikifurries edited DarkXander
8: 4 wikifurries edited List of main characters in Alvin and the Chipmunks
9: 4 wikifurries edited Furry Fiesta
10: 3 wikifurries edited Drake Dragon
11: 3 wikifurries edited Clifford the Big Red Dog
12: 3 wikifurries edited Kemoner (website)
13: 3 wikifurries edited R.C. Fox
14: 3 wikifurries edited Furry Weekend Holland
15: 3 wikifurries edited Izzy Featherbrain
16: 3 wikifurries edited Tony the Tiger
17: 3 wikifurries edited List of in-person furry conventions by attendance
18: 3 wikifurries edited Kevin Duane
19: 3 wikifurries edited Fredryk Phox
20: 2 wikifurries edited Tom and Jerry
21: 2 wikifurries edited Perri Lightfoot
22: 2 wikifurries edited Stephanie Jones
23: 2 wikifurries edited Jen Starfall
24: 2 wikifurries edited Yumil
25: 2 wikifurries edited Laser Raccoon

abr 2016

1: 6 wikifurries edited Blaya
2: 6 wikifurries edited DangerDoberman
3: 5 wikifurries edited Fursona
4: 4 wikifurries edited Spike Blackfang
5: 4 wikifurries edited Inflation
6: 3 wikifurries edited Tokala (United Kingdom)
7: 3 wikifurries edited Quick Draw McGraw
8: 3 wikifurries edited Furry Raiders
9: 3 wikifurries edited Babar
10: 3 wikifurries edited Karu Panda
11: 3 wikifurries edited Shanghai Furry Summer Festival
12: 3 wikifurries edited Cartoon Network
13: 3 wikifurries edited Sage Bamaisin
14: 3 wikifurries edited Just Fur The Weekend
15: 3 wikifurries edited Fur the 'More 2016
16: 3 wikifurries edited Furry Weekend Atlanta 2016
17: 3 wikifurries edited Motor City Furry Con
18: 3 wikifurries edited Dodge The Wolf
19: 3 wikifurries edited Transmission
20: 3 wikifurries edited Gatorbox
21: 3 wikifurries edited Fur the 'More
22: 3 wikifurries edited David Cramer
23: 3 wikifurries edited Shere Khan
24: 3 wikifurries edited WhiteFire
25: 3 wikifurries edited Yiff

mai 2016

1: 6 wikifurries edited Transmission
2: 6 wikifurries edited List of in-person furry conventions by attendance
3: 5 wikifurries edited Stray-Sketches
4: 5 wikifurries edited Fursona
5: 4 wikifurries edited JBadger
6: 3 wikifurries edited Chloe.Hydraconis
7: 3 wikifurries edited Kait0
8: 3 wikifurries edited Furry Network (art archive)
9: 3 wikifurries edited Chero Pawfree
10: 3 wikifurries edited Pilli10
11: 3 wikifurries edited Glitch
12: 3 wikifurries edited List of fursuit dance competition results
13: 3 wikifurries edited Runt-Abu
14: 3 wikifurries edited The Nostalgia Critic
15: 3 wikifurries edited Pandez
16: 3 wikifurries edited History of Fur Affinity
17: 3 wikifurries edited Leavin' the Con
18: 3 wikifurries edited Herpy: Reptile Lovers' Community
19: 3 wikifurries edited Sweet Treats - Easy-To-Make Dessert Recipes from the Kitchen of Marsha Redfox
20: 3 wikifurries edited Scotty Arsenault
21: 2 wikifurries edited The Whistler
22: 2 wikifurries edited Space Pirate Captain MacTaggart
23: 2 wikifurries edited K1M--BUTT
24: 2 wikifurries edited Culturally F'd
25: 2 wikifurries edited Takuma Kitsune

jun 2016

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Pinkie Posh
3: 3 wikifurries edited Furry Retreat
4: 3 wikifurries edited LazuliLady
5: 3 wikifurries edited Marcus Blue Wolf
6: 3 wikifurries edited Trybal Wolf
7: 3 wikifurries edited CanFURence
8: 3 wikifurries edited Just Fur The Weekend
9: 3 wikifurries edited Iris Jay
10: 3 wikifurries edited Mole
11: 3 wikifurries edited Pika
12: 3 wikifurries edited Sam Starfall
13: 3 wikifurries edited Pig
14: 3 wikifurries edited Badger
15: 3 wikifurries edited Dolphin
16: 3 wikifurries edited Cheetah
17: 3 wikifurries edited Lion
18: 3 wikifurries edited Fox
19: 2 wikifurries edited Kaiden RaveWulf
20: 2 wikifurries edited Clawhauser
21: 2 wikifurries edited Tokenworks
22: 2 wikifurries edited Gurglr
23: 2 wikifurries edited Frederic
24: 2 wikifurries edited KovuLKD
25: 2 wikifurries edited FredericHusky

jul 2016

1: 5 wikifurries edited List of characters in Housepets!
2: 4 wikifurries edited Flutters Jay
3: 4 wikifurries edited Po Ping
4: 3 wikifurries edited Redwall Wars Wiki
5: 3 wikifurries edited Chero Pawfree
6: 3 wikifurries edited Rabbit
7: 3 wikifurries edited Anthrocon
8: 2 wikifurries edited Nirfurvious
9: 2 wikifurries edited Icaron
10: 2 wikifurries edited Sporty
11: 2 wikifurries edited SalemtheCruel
12: 2 wikifurries edited Bluestripe the Wild
13: 2 wikifurries edited Shaza
14: 2 wikifurries edited The Lil' Five
15: 2 wikifurries edited Gren
16: 2 wikifurries edited Tarnfalk
17: 2 wikifurries edited Strypes the Tiger
18: 2 wikifurries edited Delicious Disguises
19: 2 wikifurries edited Drakonman
20: 2 wikifurries edited Nevrean
21: 2 wikifurries edited Peter Soyer Beagle
22: 2 wikifurries edited CraftyAndy
23: 2 wikifurries edited FurrTrax
24: 2 wikifurries edited Joshua Adam Bates
25: 2 wikifurries edited Panda Paco

ago 2016

1: 3 wikifurries edited FoxArvid
2: 3 wikifurries edited List of in-person furry conventions by attendance
3: 3 wikifurries edited Robert Hill
4: 2 wikifurries edited YIFFØ
5: 2 wikifurries edited Furry.FM
6: 2 wikifurries edited Yak
7: 2 wikifurries edited S.W.I.N.E.
8: 2 wikifurries edited Veyron
9: 2 wikifurries edited Vialu
10: 2 wikifurries edited Fireflufferz
11: 2 wikifurries edited Rocko the Fox
12: 2 wikifurries edited Vimto
13: 2 wikifurries edited Being a Furry Can Change Your Life
14: 2 wikifurries edited Anthro Northwest
15: 2 wikifurries edited Alaskah
16: 2 wikifurries edited Gren
17: 2 wikifurries edited Enrich Achterberg
18: 2 wikifurries edited Tali Aurora
19: 2 wikifurries edited Sini
20: 2 wikifurries edited Bexis
21: 2 wikifurries edited List of fursuit dance competition results
22: 2 wikifurries edited Lemonade Coyote
23: 2 wikifurries edited Rocko
24: 2 wikifurries edited Kaycee
25: 2 wikifurries edited Flash the Fox

set 2016

1: 8 wikifurries edited Alvin and the Chipmunks
2: 7 wikifurries edited Alvin Seville
3: 6 wikifurries edited Chipmunk
4: 4 wikifurries edited Brasil FurFest
5: 4 wikifurries edited Sergal
6: 3 wikifurries edited Boxsona Subscription Service
7: 3 wikifurries edited Prince Vaxis
8: 3 wikifurries edited Furry Migration
9: 3 wikifurries edited Koroshi
10: 3 wikifurries edited List of in-person furry conventions by attendance
11: 3 wikifurries edited Fursona
12: 2 wikifurries edited Maitre Joker
13: 2 wikifurries edited Panda
14: 2 wikifurries edited Hey Neeters!
15: 2 wikifurries edited Leonard
16: 2 wikifurries edited Leonard (fursuiter)
17: 2 wikifurries edited Solis Astral
18: 2 wikifurries edited Bowen Whitehooves
19: 2 wikifurries edited Furboliche
20: 2 wikifurries edited Bookshelf Bear
21: 2 wikifurries edited Arle
22: 2 wikifurries edited Neotheta
23: 2 wikifurries edited Cóyotl Awards
24: 2 wikifurries edited Alvin and the Chipmunks Meet the Wolfman
25: 2 wikifurries edited Babysitting Cream

out 2016

1: 3 wikifurries edited Toris Gray
2: 3 wikifurries edited Echo Oblivion
3: 3 wikifurries edited Zimmimaru
4: 2 wikifurries edited Jayef
5: 2 wikifurries edited Saoirse96
6: 2 wikifurries edited DuskTheRaccoon
7: 2 wikifurries edited Darkmane Arweinydd
8: 2 wikifurries edited Brandi Fletcher
9: 2 wikifurries edited Jākē
10: 2 wikifurries edited Paw Print Radio
11: 2 wikifurries edited FOUSE Radio
12: 2 wikifurries edited EHH123
13: 2 wikifurries edited Eurofurence 22
14: 2 wikifurries edited Wild Things
15: 2 wikifurries edited TheHuskyK9
16: 2 wikifurries edited Scape Goat
17: 2 wikifurries edited Sergal
18: 2 wikifurries edited Wolfie Rankin
19: 2 wikifurries edited Dallas Regional Anthropomorphic Meeting Association
20: 2 wikifurries edited Molly
21: 2 wikifurries edited CynWolfe
22: 2 wikifurries edited Star Wars
23: 2 wikifurries edited Thallanor Rasmuson
24: 1 wikifurries edited Elmer (comics)

nov 2016

1: 4 wikifurries edited Fanta the Fox
2: 4 wikifurries edited COMMONER
3: 3 wikifurries edited Greg the Husky
4: 3 wikifurries edited MyHeartPumpsPiss
5: 3 wikifurries edited Anal Fox 64
6: 3 wikifurries edited Minors Movement
7: 3 wikifurries edited LuvBites
8: 3 wikifurries edited Farble
9: 3 wikifurries edited Chris Shadow Hunter
10: 3 wikifurries edited Darkmane Arweinydd
11: 3 wikifurries edited UCF Furs
12: 3 wikifurries edited Mephit Fur Meet 2016
13: 3 wikifurries edited Golden Leaves Con
14: 3 wikifurries edited Myke Patton
15: 3 wikifurries edited List of in-person furry conventions by attendance
16: 3 wikifurries edited Scar
17: 2 wikifurries edited Hircreacc
18: 2 wikifurries edited Punkster
19: 2 wikifurries edited Greg The Husky
20: 2 wikifurries edited Furrydelphia
21: 2 wikifurries edited AnalFisting
22: 2 wikifurries edited Xenchiiru
23: 2 wikifurries edited Porin
24: 2 wikifurries edited Feral! 2017
25: 2 wikifurries edited Comet Fireclaw

dez 2016

1: 13 wikifurries edited Scar
2: 7 wikifurries edited Kyle Lambert
3: 5 wikifurries edited Plushophilia
4: 4 wikifurries edited Vincent Hayes
5: 4 wikifurries edited Midwest FurFest 2016
6: 4 wikifurries edited Ristin
7: 4 wikifurries edited QuasiSkunk
8: 4 wikifurries edited List of in-person furry conventions by attendance
9: 4 wikifurries edited Midwest FurFest
10: 3 wikifurries edited Akuma Datboi
11: 3 wikifurries edited Arvada Tails
12: 3 wikifurries edited FoxRunTime
13: 3 wikifurries edited Tigran
14: 3 wikifurries edited Hexxy
15: 3 wikifurries edited Crinkle Corner
16: 3 wikifurries edited Furrnion
17: 3 wikifurries edited Ari
18: 3 wikifurries edited BanWynn Oakshadow
19: 3 wikifurries edited Long Island Furs
20: 3 wikifurries edited Furfag
21: 3 wikifurries edited Shere Khan
22: 3 wikifurries edited High Tail Hall
23: 3 wikifurries edited Furry Weekend Atlanta
24: 3 wikifurries edited Fox
25: 3 wikifurries edited Babyfur

jan 2017

1: 4 wikifurries edited Bino Smith
2: 4 wikifurries edited Xavier Tan
3: 4 wikifurries edited Groo Aussieroo
4: 4 wikifurries edited LupineFox
5: 4 wikifurries edited List of in-person furry conventions by attendance
6: 4 wikifurries edited Scar
7: 3 wikifurries edited ShaxFox
8: 3 wikifurries edited Vylette Dobie
9: 3 wikifurries edited FireIceWolf
10: 3 wikifurries edited Kitaii
11: 3 wikifurries edited Runenora
12: 3 wikifurries edited Rob Maestro
13: 3 wikifurries edited Audence
14: 3 wikifurries edited Stellar Babe
15: 3 wikifurries edited Paddington Bear
16: 3 wikifurries edited Dave247
17: 3 wikifurries edited Inkwell Artz
18: 3 wikifurries edited Raven Foxx
19: 3 wikifurries edited FoxRunTime
20: 3 wikifurries edited Darkmane Arweinydd
21: 3 wikifurries edited Rainy Chaos
22: 3 wikifurries edited Tarnfalk
23: 3 wikifurries edited List of fursuit dance competition results
24: 3 wikifurries edited ConFurgence
25: 3 wikifurries edited Nickwolf

fev 2017

1: 6 wikifurries edited Yiff Lounge
2: 5 wikifurries edited Elmer (comics)
3: 5 wikifurries edited The Zeta Corner
4: 5 wikifurries edited LupineFox
5: 4 wikifurries edited Blithe
6: 4 wikifurries edited Fenris Wolfbane
7: 4 wikifurries edited Anime
8: 3 wikifurries edited Virmir
9: 3 wikifurries edited FrostiBunni
10: 3 wikifurries edited Sprrigs
11: 3 wikifurries edited Lost-Soul
12: 3 wikifurries edited Sun-Dial
13: 3 wikifurries edited Draconigen
14: 3 wikifurries edited Tokyo Afterschool Summoners
15: 3 wikifurries edited What The Fur 2017
16: 3 wikifurries edited Zabivaka
17: 3 wikifurries edited 2016/2017 child abuse arrests
18: 3 wikifurries edited Tykko Kerensky
19: 3 wikifurries edited Emerald Fur Con
20: 3 wikifurries edited Luna Crescens
21: 3 wikifurries edited Itsukine
22: 3 wikifurries edited Sparkledog
23: 3 wikifurries edited What The Fur
24: 3 wikifurries edited NorthEast Ohio Furs
25: 3 wikifurries edited Deviant Desires

mar 2017

1: 4 wikifurries edited RainFurrest
2: 4 wikifurries edited Furry Fiesta
3: 4 wikifurries edited Takaza J. Wolf
4: 3 wikifurries edited Meisarrg
5: 3 wikifurries edited Drake Foxe
6: 3 wikifurries edited Toris Gray
7: 3 wikifurries edited Skoryx
8: 3 wikifurries edited Catfight
9: 3 wikifurries edited Faux-Pa
10: 3 wikifurries edited BerriPop
11: 3 wikifurries edited Andrew Lupin
12: 3 wikifurries edited Leo Elstar
13: 3 wikifurries edited Ian Schue
14: 3 wikifurries edited My Neighbor Totoro
15: 3 wikifurries edited Ankoku Yokohama
16: 3 wikifurries edited VancouFur 2017
17: 3 wikifurries edited MakiaVi
18: 3 wikifurries edited Tuqiri
19: 3 wikifurries edited Gre7g
20: 2 wikifurries edited Slick Kat
21: 2 wikifurries edited Gammachaos
22: 2 wikifurries edited Realfreedom
23: 2 wikifurries edited Kothorix
24: 2 wikifurries edited Wyld
25: 2 wikifurries edited Anthro Weekend Utah

abr 2017

1: 10 wikifurries edited Rocky Mountain Fur Con
2: 6 wikifurries edited Kahuki Lairu
3: 6 wikifurries edited List of in-person furry conventions by attendance
4: 5 wikifurries edited The Zeta Corner
5: 5 wikifurries edited Rocky Mountain Fur Con 2017
6: 5 wikifurries edited Clopping
7: 3 wikifurries edited Elmer (comics)
8: 3 wikifurries edited Foxler Nightfire
9: 3 wikifurries edited Vennix
10: 3 wikifurries edited Ratchet Fox (Florida)
11: 3 wikifurries edited Lexie Dragonwolf
12: 3 wikifurries edited Baphi
13: 3 wikifurries edited Sinaherib
14: 3 wikifurries edited Micro Fur Con
15: 3 wikifurries edited Furry Raiders
16: 3 wikifurries edited Deo Vacuus
17: 3 wikifurries edited Connor Goodwolf
18: 3 wikifurries edited Luke Mortora
19: 3 wikifurries edited Yiff
20: 2 wikifurries edited Furry Central (United Kingdom)
21: 2 wikifurries edited Gamer Den
22: 2 wikifurries edited Boozy Barrister
23: 2 wikifurries edited Wild Prairie Fur Con
24: 2 wikifurries edited IrishWolf Lythi
25: 2 wikifurries edited Weasel Press

mai 2017

1: 5 wikifurries edited Zipzap
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Skorpion DX
4: 4 wikifurries edited Animal Planet
5: 4 wikifurries edited Redstorm Fursuits
6: 4 wikifurries edited Rocky Mountain Fur Con
7: 3 wikifurries edited AquatiFur
8: 3 wikifurries edited Chazore Ayres
9: 3 wikifurries edited Karumaru
10: 3 wikifurries edited Wild Gadget
11: 3 wikifurries edited Muffle (fursuiter)
12: 3 wikifurries edited Dragoshi
13: 3 wikifurries edited Ånders
14: 3 wikifurries edited Zaro Wolf
15: 3 wikifurries edited Kitkat Cabbit
16: 3 wikifurries edited Antiquity Varmint
17: 3 wikifurries edited Vennix
18: 3 wikifurries edited 2016/2017 child abuse arrests
19: 3 wikifurries edited Rocky Mountain Fur Con 2017
20: 3 wikifurries edited DuskTheRaccoon
21: 3 wikifurries edited Fluff-Kevlar
22: 3 wikifurries edited Zaishi Mai
23: 3 wikifurries edited Marko the Rat
24: 3 wikifurries edited FENEC Adventures
25: 2 wikifurries edited Sugar Paw Creations

jun 2017

1: 4 wikifurries edited Dangered Wolf
2: 4 wikifurries edited Gaz Mynta
3: 4 wikifurries edited List of in-person furry conventions by attendance
4: 3 wikifurries edited Digital Fennec
5: 3 wikifurries edited B4dw01f
6: 3 wikifurries edited LeedsFurs
7: 3 wikifurries edited Jordann William Edwards
8: 3 wikifurries edited Drake Kilchii
9: 3 wikifurries edited I.S.A.C.
10: 3 wikifurries edited Xzavior Wolf
11: 3 wikifurries edited Fox Tails (novel)
12: 3 wikifurries edited A Fox Tail
13: 3 wikifurries edited Ochropus
14: 3 wikifurries edited Foxler Nightfire
15: 3 wikifurries edited Toris Gray
16: 3 wikifurries edited Ino
17: 3 wikifurries edited Character sheet
18: 3 wikifurries edited Blaster Hedgie
19: 2 wikifurries edited Riley Winters
20: 2 wikifurries edited Shavano
21: 2 wikifurries edited Big Sky Camp Paw
22: 2 wikifurries edited DrawHolic
23: 2 wikifurries edited
24: 2 wikifurries edited ColorWorld Universe
25: 2 wikifurries edited The Dynamite Twins and Friends

jul 2017

1: 5 wikifurries edited
2: 4 wikifurries edited Howloween
3: 3 wikifurries edited Haphizard
4: 3 wikifurries edited Boozy Barrister
5: 3 wikifurries edited Alamo City Furry Invasion
6: 3 wikifurries edited Califur 2017
7: 3 wikifurries edited Pandr P. Panda
8: 3 wikifurries edited Tyson Tan
9: 3 wikifurries edited Duncan da Husky
10: 2 wikifurries edited Brifnar The Bear
11: 2 wikifurries edited Furry Time
12: 2 wikifurries edited Beau
13: 2 wikifurries edited Soatok Dreamseeker
14: 2 wikifurries edited IrishFurries
15: 2 wikifurries edited Darky
16: 2 wikifurries edited Silent Sillies
17: 2 wikifurries edited Exclipze
18: 2 wikifurries edited August Ravvingar
19: 2 wikifurries edited Adam Thomas Applebaum
20: 2 wikifurries edited Syynx
21: 2 wikifurries edited Leeoh Fox
22: 2 wikifurries edited Foxler Nightfire
23: 2 wikifurries edited Minnie Shoof
24: 2 wikifurries edited What The Fur 2017
25: 2 wikifurries edited 2016/2017 child abuse arrests

ago 2017

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Zaxtor Znort
3: 3 wikifurries edited Kooskia
4: 3 wikifurries edited Malicai
5: 3 wikifurries edited Glitch (content creator)
6: 3 wikifurries edited Brifnar The Bear
7: 3 wikifurries edited Melvis Barksy
8: 3 wikifurries edited 2016/2017 child abuse arrests
9: 3 wikifurries edited Transmission
10: 3 wikifurries edited Crusader Cat
11: 3 wikifurries edited Roarey Raccoon
12: 3 wikifurries edited Ravenwood
13: 3 wikifurries edited Encyclopædia Dramatica
14: 2 wikifurries edited Maitre Joker
15: 2 wikifurries edited Felicesta
16: 2 wikifurries edited Niru Whiteshibe
17: 2 wikifurries edited Kiki the Cyber Squirrel
18: 2 wikifurries edited
19: 2 wikifurries edited Kat-Venture
20: 2 wikifurries edited Scpkid
21: 2 wikifurries edited Jalen Folf
22: 2 wikifurries edited Bloodline (webcomic)
23: 2 wikifurries edited Anaria
24: 2 wikifurries edited Fenny
25: 2 wikifurries edited Coonix

set 2017

1: 5 wikifurries edited Zaxtor Znort
2: 4 wikifurries edited Bluethefox
3: 4 wikifurries edited Brifnar The Bear
4: 4 wikifurries edited Toxxik Fox
5: 4 wikifurries edited PlymouthFurs
6: 3 wikifurries edited Meisarrg
7: 3 wikifurries edited Azzre
8: 3 wikifurries edited Wet Female Furries
9: 3 wikifurries edited Lynsdey Black
10: 3 wikifurries edited Furry Raiders
11: 3 wikifurries edited Brasil FurFest
12: 3 wikifurries edited Thipher
13: 3 wikifurries edited Neko (term)
14: 3 wikifurries edited KinkyTurtle
15: 2 wikifurries edited Coco Rapidpaws
16: 2 wikifurries edited Bleu SnowiePaws
17: 2 wikifurries edited Camaro Cougar
18: 2 wikifurries edited MechaPuma
19: 2 wikifurries edited Sixam
20: 2 wikifurries edited Corvus
21: 2 wikifurries edited Quartz Husky
22: 2 wikifurries edited Asphyxia Lemieux
23: 2 wikifurries edited Mr. Mephit
24: 2 wikifurries edited KaiGShep
25: 2 wikifurries edited Chopper Coyote

out 2017

1: 7 wikifurries edited R.C. Fox
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 3 wikifurries edited Kutsivi
4: 3 wikifurries edited Colorado Furries
5: 3 wikifurries edited Tigeneer
6: 3 wikifurries edited Stella the Cat
7: 3 wikifurries edited Star
8: 3 wikifurries edited Flüüfff
9: 3 wikifurries edited AquatiFur
10: 3 wikifurries edited Harbour City Fur Con
11: 3 wikifurries edited Thaitails
12: 3 wikifurries edited Furcation
13: 3 wikifurries edited Furpocalypse
14: 3 wikifurries edited WikiFur
15: 3 wikifurries edited Kemono
16: 2 wikifurries edited Coco Rapidpaws
17: 2 wikifurries edited Groovy
18: 2 wikifurries edited Cyiance Fiction
19: 2 wikifurries edited Gene Diver
20: 2 wikifurries edited Sunweavers
21: 2 wikifurries edited Taryn Amita
22: 2 wikifurries edited HooskyDawg
23: 2 wikifurries edited James Firefox
24: 2 wikifurries edited Ace Fawx
25: 2 wikifurries edited Parsonsda

nov 2017

1: 5 wikifurries edited Space Pirate Captain MacTaggart
2: 4 wikifurries edited Flüüfff
3: 4 wikifurries edited List of in-person furry conventions by attendance
4: 3 wikifurries edited Sprite Limehead
5: 3 wikifurries edited Riku Firefox
6: 3 wikifurries edited Meisarrg
7: 3 wikifurries edited Kabba
8: 3 wikifurries edited Kelo
9: 3 wikifurries edited Goldenwolf (fursuiter)
10: 3 wikifurries edited Equivamp
11: 2 wikifurries edited Austin furry dance
12: 2 wikifurries edited Azuli (New England)
13: 2 wikifurries edited Gayfurrystuff
14: 2 wikifurries edited Elle
15: 2 wikifurries edited The Lumarions
16: 2 wikifurries edited Hector Bomb
17: 2 wikifurries edited Zepto
18: 2 wikifurries edited Shadowfaxi
19: 2 wikifurries edited Aww, Feathers!
20: 2 wikifurries edited Scarbo
21: 2 wikifurries edited Kaz (Brisbane)
22: 2 wikifurries edited Alamo City Furry Invasion Fictional Universe
23: 2 wikifurries edited DenFur
24: 2 wikifurries edited Catfight
25: 2 wikifurries edited 2016/2017 child abuse arrests

dez 2017

1: 8 wikifurries edited Dionysius Tragos
2: 6 wikifurries edited Transmission
3: 6 wikifurries edited List of in-person furry conventions by attendance
4: 5 wikifurries edited Magnus Diridian
5: 4 wikifurries edited Genitalia
6: 4 wikifurries edited Wolfhome
7: 4 wikifurries edited Midwest FurFest
8: 3 wikifurries edited Coco Rapidpaws
9: 3 wikifurries edited EmberFox
10: 3 wikifurries edited PepsiFox
11: 3 wikifurries edited Quuxum Mephitida
12: 3 wikifurries edited Foxler Nightfire
13: 3 wikifurries edited Midwest FurFest 2017
14: 3 wikifurries edited Lavadog Ashpaw
15: 3 wikifurries edited Furs Upon Malaysia
16: 3 wikifurries edited Majira Strawberry
17: 3 wikifurries edited Floyd (fursuiter)
18: 2 wikifurries edited What the Fluff
19: 2 wikifurries edited Took Southpaw
20: 2 wikifurries edited Confuror
21: 2 wikifurries edited The Autumnlands
22: 2 wikifurries edited Foxfyre Recluse
23: 2 wikifurries edited Dobermom
24: 2 wikifurries edited Wolfoup
25: 2 wikifurries edited TransFerret

jan 2018

1: 4 wikifurries edited List of in-person furry conventions by attendance
2: 3 wikifurries edited Sasha Talas
3: 3 wikifurries edited Madcatlady
4: 3 wikifurries edited Anthro Crossroads East
5: 3 wikifurries edited Cloud Husky Landar
6: 3 wikifurries edited Ursidae Suits
7: 3 wikifurries edited Rohkor Fenix
8: 3 wikifurries edited Majira Strawberry
9: 3 wikifurries edited Japan Meeting of Furries
10: 3 wikifurries edited Marc S. Tucker
11: 3 wikifurries edited LupineFox
12: 3 wikifurries edited Anonymous (group)
13: 3 wikifurries edited Jim Tarpley
14: 3 wikifurries edited Bunnicula
15: 2 wikifurries edited Sweet Tart
16: 2 wikifurries edited Splat Fennec
17: 2 wikifurries edited Growl Podcast
18: 2 wikifurries edited Zuri (The Lion Guard)
19: 2 wikifurries edited Tiifu
20: 2 wikifurries edited Delta Akhlut
21: 2 wikifurries edited Rinzue
22: 2 wikifurries edited Phoenix Sheppy
23: 2 wikifurries edited In the Pond
24: 2 wikifurries edited Under the Bandstand
25: 2 wikifurries edited Bandstand

fev 2018

1: 8 wikifurries edited List of in-person furry conventions by attendance
2: 7 wikifurries edited Zidonuke
3: 6 wikifurries edited Fox-Jake
4: 4 wikifurries edited Lambda
5: 4 wikifurries edited Convention Master
6: 3 wikifurries edited Furme
7: 3 wikifurries edited FLEF
8: 3 wikifurries edited FurCamp
9: 3 wikifurries edited Scraps The Fox
10: 3 wikifurries edited TaruTime
11: 3 wikifurries edited Rasha
12: 3 wikifurries edited P4-34-M0
13: 3 wikifurries edited AquatiFur
14: 3 wikifurries edited Anthro New England 2018
15: 3 wikifurries edited Isolation Play
16: 3 wikifurries edited Chris Sanders
17: 2 wikifurries edited Dead Dog Running
18: 2 wikifurries edited Chris Sharkson
19: 2 wikifurries edited Avery Miller
20: 2 wikifurries edited Kayla la
21: 2 wikifurries edited Mamath
22: 2 wikifurries edited Wolfletech
23: 2 wikifurries edited Ambi
24: 2 wikifurries edited Box Otto
25: 2 wikifurries edited Stu Shiffman

mar 2018

1: 8 wikifurries edited R.C. Fox
2: 5 wikifurries edited Prince Vaxis
3: 5 wikifurries edited List of in-person furry conventions by attendance
4: 4 wikifurries edited Califur 2018
5: 4 wikifurries edited Zidonuke
6: 4 wikifurries edited
7: 3 wikifurries edited Tyke Braxe
8: 3 wikifurries edited AxxiosGrey
9: 3 wikifurries edited Squirrel and Hedgehog
10: 3 wikifurries edited Zaxtor Znort
11: 3 wikifurries edited CynWolfe
12: 3 wikifurries edited EosFoxx
13: 2 wikifurries edited Fox in a Jacket
14: 2 wikifurries edited Cross Hyparu
15: 2 wikifurries edited Kimba (Toronto)
16: 2 wikifurries edited Fuzzy Lumkin
17: 2 wikifurries edited Koorivlf
18: 2 wikifurries edited Furtropolis
19: 2 wikifurries edited Felix SilverClaw
20: 2 wikifurries edited KornGP47
21: 2 wikifurries edited Techimal
22: 2 wikifurries edited Sukal
23: 2 wikifurries edited Camping Paws
24: 2 wikifurries edited Furme
25: 2 wikifurries edited Sweet Tart

abr 2018

1: 8 wikifurries edited List of in-person furry conventions by attendance
2: 6 wikifurries edited Akira7
3: 4 wikifurries edited Binghar
4: 4 wikifurries edited Socks
5: 4 wikifurries edited Simon Tesla
6: 4 wikifurries edited Adoptable
7: 4 wikifurries edited R.C. Fox
8: 4 wikifurries edited Kemono
9: 3 wikifurries edited Conner Teters
10: 3 wikifurries edited RockyToonzComics
11: 3 wikifurries edited Amyloup
12: 3 wikifurries edited Astarcis
13: 3 wikifurries edited Dream and Nightmare
14: 3 wikifurries edited AxelPanic
15: 3 wikifurries edited Kawaiidogarts
16: 3 wikifurries edited DamagedDolphin
17: 3 wikifurries edited Galaxy Town
18: 3 wikifurries edited Kovuah
19: 3 wikifurries edited Colt Azayaka
20: 3 wikifurries edited Hyena Agenda
21: 3 wikifurries edited Fox-Jake
22: 3 wikifurries edited Faolan (Netherlands)
23: 3 wikifurries edited Khord Kitty
24: 3 wikifurries edited Brenda Banks
25: 3 wikifurries edited Zidonuke

mai 2018

1: 5 wikifurries edited A Furry Future
2: 5 wikifurries edited The Depths
3: 5 wikifurries edited List of in-person furry conventions by attendance
4: 4 wikifurries edited List of fursuit dance competition results
5: 4 wikifurries edited Wolfhome
6: 3 wikifurries edited
7: 3 wikifurries edited FoxTail
8: 3 wikifurries edited Boop
9: 3 wikifurries edited Jax (furry fan)
10: 3 wikifurries edited Bowlfurria
11: 3 wikifurries edited Spring-the-husky
12: 3 wikifurries edited Tsunami
13: 3 wikifurries edited Bengt
14: 3 wikifurries edited Over Time
15: 3 wikifurries edited Biggest Little Fur Con 2018
16: 3 wikifurries edited Bid the Beaver
17: 3 wikifurries edited Furry Raiders
18: 3 wikifurries edited Fox-Jake
19: 3 wikifurries edited Kayla-Na
20: 3 wikifurries edited Babs Bunny (person)
21: 3 wikifurries edited Foxxel Pobieski
22: 3 wikifurries edited Panda Jenn
23: 3 wikifurries edited Wolf Comix
24: 3 wikifurries edited Judas & Jesus
25: 3 wikifurries edited Crusader Cat

jun 2018

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Avi Fox
3: 4 wikifurries edited Valmir Aker
4: 3 wikifurries edited Coma Ekliptik
5: 3 wikifurries edited Dumbo
6: 3 wikifurries edited The Phoenix Nest
7: 3 wikifurries edited A Furry Future
8: 3 wikifurries edited Saphy (artist)
9: 3 wikifurries edited Zombyeen
10: 3 wikifurries edited The Bear Guy
11: 3 wikifurries edited Wolf Comix
12: 3 wikifurries edited Horndog
13: 3 wikifurries edited DaeCoon
14: 3 wikifurries edited PDXFurs
15: 3 wikifurries edited Cub
16: 3 wikifurries edited
17: 2 wikifurries edited Furst Responders
18: 2 wikifurries edited Howlr
19: 2 wikifurries edited Johann Faust
20: 2 wikifurries edited Connor Darktail
21: 2 wikifurries edited Tempo Robinson
22: 2 wikifurries edited Chemicalcrux
23: 2 wikifurries edited Haunter Husky
24: 2 wikifurries edited P4ndora-L
25: 2 wikifurries edited Ice Age

jul 2018

1: 5 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Inflation
3: 3 wikifurries edited Skunk Mantra
4: 3 wikifurries edited Kitsunerumai
5: 3 wikifurries edited Emilee
6: 3 wikifurries edited RainFurrest
7: 3 wikifurries edited Anthrocon
8: 2 wikifurries edited Ultra
9: 2 wikifurries edited Zasz
10: 2 wikifurries edited Seth The Fennec
11: 2 wikifurries edited Koorivlf
12: 2 wikifurries edited FurCamp
13: 2 wikifurries edited Bid the Beaver
14: 2 wikifurries edited Poim
15: 2 wikifurries edited Poweron
16: 2 wikifurries edited Aaron
17: 2 wikifurries edited Majira Strawberry
18: 2 wikifurries edited Biggest Little Fur Con
19: 2 wikifurries edited NinjaRisu NineTails
20: 2 wikifurries edited Flicker
21: 2 wikifurries edited Volk Zadovsky
22: 2 wikifurries edited Icepaws
23: 2 wikifurries edited Taursuit

ago 2018

1: 5 wikifurries edited Furry Broadcasting Network
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited LupineFox
4: 4 wikifurries edited Vicky Wyman
5: 3 wikifurries edited 4lung
6: 3 wikifurries edited Kyle McCarthy
7: 3 wikifurries edited Megaplex
8: 2 wikifurries edited Fluke Husky
9: 2 wikifurries edited Craig Black
10: 2 wikifurries edited Aethyr
11: 2 wikifurries edited Chinona
12: 2 wikifurries edited Rainy
13: 2 wikifurries edited Digital Wolfy
14: 2 wikifurries edited PinkFur17
15: 2 wikifurries edited Teresa Warner
16: 2 wikifurries edited Howlr
17: 2 wikifurries edited Conner Teters
18: 2 wikifurries edited Kahoku Nova
19: 2 wikifurries edited Missing the Innocence
20: 2 wikifurries edited RC Wolf
21: 2 wikifurries edited Corvus
22: 2 wikifurries edited The Dynamite Twins and Friends
23: 2 wikifurries edited Foxler Nightfire
24: 2 wikifurries edited Wild Prairie Fur Con
25: 2 wikifurries edited PozFur

set 2018

1: 6 wikifurries edited Fat furs
2: 4 wikifurries edited Caffeine Fox
3: 4 wikifurries edited Brasil FurFest
4: 4 wikifurries edited Duragan
5: 3 wikifurries edited Hexawolf
6: 3 wikifurries edited Kero The Wolf (USA)
7: 3 wikifurries edited Ball State University Anthropomorphic Art Society
8: 3 wikifurries edited Jasonafex
9: 3 wikifurries edited Blaze Arctic
10: 3 wikifurries edited Tomoya
11: 3 wikifurries edited Connor Goodwolf
12: 3 wikifurries edited Furry-Muscle
13: 3 wikifurries edited HTH Studios
14: 3 wikifurries edited Fifteen Rabbits
15: 3 wikifurries edited Dnapalmhead
16: 3 wikifurries edited List of in-person furry conventions by attendance
17: 3 wikifurries edited RainRat
18: 3 wikifurries edited Something Awful
19: 2 wikifurries edited Splash Fusky
20: 2 wikifurries edited Zoosadist Evidence
21: 2 wikifurries edited SpokAnthro
22: 2 wikifurries edited Baby Blu
23: 2 wikifurries edited Brasil FurFest 2018
24: 2 wikifurries edited Brasil FurFest 2017
25: 2 wikifurries edited Brasil FurFest 2016

out 2018

1: 6 wikifurries edited Wild North
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Furpocalypse
4: 3 wikifurries edited Zoosadist Evidence
5: 3 wikifurries edited Prince Vaxis
6: 3 wikifurries edited AK
7: 3 wikifurries edited CynWolfe
8: 2 wikifurries edited Argentina FurFiesta
9: 2 wikifurries edited YiffyFur
10: 2 wikifurries edited Kero The Wolf (USA)
11: 2 wikifurries edited Caffeine Fox
12: 2 wikifurries edited Smol Fur Hangout
13: 2 wikifurries edited Conner Teters
14: 2 wikifurries edited HooskyDawg
15: 2 wikifurries edited Charles A. Brubaker
16: 2 wikifurries edited Foxler Nightfire
17: 2 wikifurries edited Swordsdragon
18: 2 wikifurries edited Vespian
19: 2 wikifurries edited Tiberius
20: 2 wikifurries edited 4lung
21: 2 wikifurries edited Anisava
22: 2 wikifurries edited Alirezatm
23: 2 wikifurries edited Kima
24: 2 wikifurries edited Majira Strawberry
25: 2 wikifurries edited FurWAG 2015

nov 2018

1: 6 wikifurries edited Kero The Wolf (USA)
2: 6 wikifurries edited List of in-person furry conventions by attendance
3: 3 wikifurries edited Fruxuyup Artist
4: 3 wikifurries edited Shyanne
5: 3 wikifurries edited Walter Albrecht
6: 3 wikifurries edited Fred Patten
7: 2 wikifurries edited FeraBowl
8: 2 wikifurries edited GreyM83
9: 2 wikifurries edited Doctor Orange
10: 2 wikifurries edited Vexare Hirano
11: 2 wikifurries edited Pamperchu
12: 2 wikifurries edited FledoTheFox
13: 2 wikifurries edited Shi the Chimera
14: 2 wikifurries edited Nelizar
15: 2 wikifurries edited Furry Central (United Kingdom)
16: 2 wikifurries edited Liggliluff
17: 2 wikifurries edited Fullerton triple homicide
18: 2 wikifurries edited AmandaDaHamster
19: 2 wikifurries edited Kitsunerumai
20: 2 wikifurries edited Forest Hill
21: 2 wikifurries edited Odin Wolf
22: 2 wikifurries edited Gulf Coast Furs
23: 2 wikifurries edited Mississippi Anthropomorphics
24: 1 wikifurries edited Undertale

dez 2018

1: 7 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Shoutmilo
3: 3 wikifurries edited Kiwi Fox
4: 3 wikifurries edited This Is Life with Lisa Ling
5: 3 wikifurries edited Kittydog
6: 3 wikifurries edited Tails and Tornadoes Fur Con
7: 3 wikifurries edited Growl Podcast
8: 3 wikifurries edited Midwest FurFest 2018
9: 3 wikifurries edited SonicFox5000
10: 3 wikifurries edited Jasonafex
11: 3 wikifurries edited TORA
12: 3 wikifurries edited Micah Coon
13: 3 wikifurries edited Shark Tale
14: 3 wikifurries edited Bounder
15: 3 wikifurries edited Robert Hill
16: 3 wikifurries edited Catgirl
17: 3 wikifurries edited Anti-furries
18: 2 wikifurries edited Growl podcast
19: 2 wikifurries edited Kabier
20: 2 wikifurries edited Void folf
21: 2 wikifurries edited Pascal Farful
22: 2 wikifurries edited Furthest Reach
23: 2 wikifurries edited Unikitty!
24: 2 wikifurries edited Stormi Folf
25: 2 wikifurries edited Mega tomnyan875

jan 2019

1: 8 wikifurries edited List of in-person furry conventions by attendance
2: 6 wikifurries edited 4lung
3: 5 wikifurries edited Kero The Wolf (USA)
4: 4 wikifurries edited Aaron8181
5: 3 wikifurries edited Zillion Ross
6: 3 wikifurries edited Aquarius Crystalwave
7: 3 wikifurries edited Ceol
8: 3 wikifurries edited Patreon
9: 3 wikifurries edited Wolfpuro
10: 3 wikifurries edited Fat furs
11: 3 wikifurries edited Funday PawPet Show
12: 2 wikifurries edited Fernando llacapan
13: 2 wikifurries edited Barry B. Benson
14: 2 wikifurries edited Gerce
15: 2 wikifurries edited Sad tigress
16: 2 wikifurries edited Aquarius (character)
17: 2 wikifurries edited SpaceNerd77
18: 2 wikifurries edited Yooka-Laylee
19: 2 wikifurries edited Nakouwolf
20: 2 wikifurries edited Fox-Pop
21: 2 wikifurries edited Truck Off
22: 2 wikifurries edited JustFurry
23: 2 wikifurries edited ArtyLoop
24: 2 wikifurries edited Eilowny
25: 2 wikifurries edited Thaitails

fev 2019

1: 6 wikifurries edited FurNet (FidoNet)
2: 5 wikifurries edited List of in-person furry conventions by attendance
3: 4 wikifurries edited Seadragom
4: 4 wikifurries edited Wolfpuro
5: 3 wikifurries edited Roses are Pink, Your Feet Really Stink
6: 3 wikifurries edited Posada Furra
7: 3 wikifurries edited Kero The Wolf (USA)
8: 3 wikifurries edited Albino-Kitsune
9: 3 wikifurries edited Bridgette's Belly
10: 3 wikifurries edited Anti-furries
11: 2 wikifurries edited PsychoBunny
12: 2 wikifurries edited Ray-Ray Rambles
13: 2 wikifurries edited Halloween Furro
14: 2 wikifurries edited Tom Sawyer
15: 2 wikifurries edited Awkward Paws
16: 2 wikifurries edited FurCan
17: 2 wikifurries edited Conner Teters
18: 2 wikifurries edited List of furry visual novels
19: 2 wikifurries edited Ruining the magic
20: 2 wikifurries edited Confuror
21: 2 wikifurries edited HooskyDawg
22: 2 wikifurries edited Ahmar Wolf
23: 2 wikifurries edited Rainy Chaos
24: 2 wikifurries edited Hyena Agenda
25: 2 wikifurries edited Majira Strawberry

mar 2019

1: 6 wikifurries edited List of in-person furry conventions by attendance
2: 5 wikifurries edited Kiki-Uma
3: 5 wikifurries edited Majira Strawberry
4: 5 wikifurries edited CynWolfe
5: 4 wikifurries edited Wild North
6: 4 wikifurries edited 4lung
7: 4 wikifurries edited Jasper
8: 3 wikifurries edited Fur the 'More 2019
9: 3 wikifurries edited Pine Fur Con
10: 3 wikifurries edited Kothorix
11: 3 wikifurries edited Thaitails
12: 3 wikifurries edited Jasonafex
13: 3 wikifurries edited Dogbomb
14: 3 wikifurries edited Zaxtor Znort
15: 3 wikifurries edited Saph
16: 3 wikifurries edited Timeline of media coverage
17: 2 wikifurries edited Jib Kodi
18: 2 wikifurries edited Jib kodi
19: 2 wikifurries edited Nifela
20: 2 wikifurries edited Tokugawo
21: 2 wikifurries edited Kabier
22: 2 wikifurries edited Furnal Equinox 2019
23: 2 wikifurries edited FurCamp
24: 2 wikifurries edited Itty Bitty Fur Con
25: 2 wikifurries edited Flüüfff

abr 2019

1: 7 wikifurries edited Dogbomb
2: 6 wikifurries edited List of in-person furry conventions by attendance
3: 5 wikifurries edited Ceol
4: 5 wikifurries edited Foxler Nightfire
5: 5 wikifurries edited Asher Heike
6: 4 wikifurries edited Timus the Fox
7: 4 wikifurries edited Séamus Ó Tuathail
8: 4 wikifurries edited Cupid the Deer
9: 4 wikifurries edited Blü the Dragon
10: 3 wikifurries edited Julien The Wolf
11: 3 wikifurries edited Toby Collie
12: 3 wikifurries edited Ryker122
13: 3 wikifurries edited Sven Fennec
14: 3 wikifurries edited Pineapple Fox
15: 3 wikifurries edited FattyDragonite
16: 3 wikifurries edited Brasil FurFest 2019
17: 3 wikifurries edited Koidel Coyote
18: 3 wikifurries edited AnthroExpo
19: 3 wikifurries edited Kabba
20: 3 wikifurries edited LoneWolfGamingn00b
21: 3 wikifurries edited Motor City Furry Con
22: 3 wikifurries edited GreenReaper
23: 2 wikifurries edited HOwOlidays
24: 2 wikifurries edited Super Lucky's Tale
25: 2 wikifurries edited Golden State Fur Con

mai 2019

1: 4 wikifurries edited Noodlescoop
2: 4 wikifurries edited Cupid the Deer
3: 3 wikifurries edited Undertale
4: 3 wikifurries edited Bluberry The Dog
5: 3 wikifurries edited TheSableKitty
6: 3 wikifurries edited BlazeWarriorWolf
7: 3 wikifurries edited AlmaX3
8: 3 wikifurries edited Wolf Ezo
9: 3 wikifurries edited Smol Fur Hangout
10: 3 wikifurries edited Bluethefox
11: 3 wikifurries edited Steeleheart Buran
12: 3 wikifurries edited Rebecca Mickley
13: 3 wikifurries edited Argyron
14: 3 wikifurries edited Wartorious
15: 3 wikifurries edited Strype (person)
16: 3 wikifurries edited List of in-person furry conventions by attendance
17: 2 wikifurries edited Ilia Kitsune
18: 2 wikifurries edited Viernes Furry
19: 2 wikifurries edited Splinter Fox Productions
20: 2 wikifurries edited Morningdew Farms
21: 2 wikifurries edited ArtRise
22: 2 wikifurries edited Stellarity
23: 2 wikifurries edited MentalLost
24: 2 wikifurries edited Roman Otter
25: 2 wikifurries edited Eliteknight

jun 2019

1: 6 wikifurries edited The Lion King 1½
2: 3 wikifurries edited Axelgoatgames
3: 3 wikifurries edited Fluke Husky
4: 3 wikifurries edited Murphy Slaugh
5: 3 wikifurries edited Odin Wolf
6: 3 wikifurries edited RainFurrest
7: 3 wikifurries edited Zoophilia
8: 2 wikifurries edited Maitre Joker
9: 2 wikifurries edited Remy
10: 2 wikifurries edited ALisawesom
11: 2 wikifurries edited Oxide Crux
12: 2 wikifurries edited Na'Go'Zi
13: 2 wikifurries edited MusicFox
14: 2 wikifurries edited Hey Esker!
15: 2 wikifurries edited Astrowolf
16: 2 wikifurries edited Woof (person)
17: 2 wikifurries edited Xanth (person)
18: 2 wikifurries edited Mana (Netherlands)
19: 2 wikifurries edited Fernando llacapan
20: 2 wikifurries edited Zaros
21: 2 wikifurries edited Koorivlf
22: 2 wikifurries edited Felix SilverClaw
23: 2 wikifurries edited Futerkon 2018
24: 2 wikifurries edited Glitch (content creator)
25: 2 wikifurries edited August Ravvingar

jul 2019

1: 10 wikifurries edited List of in-person furry conventions by attendance
2: 9 wikifurries edited Majira Strawberry
3: 7 wikifurries edited Kiwi Fox
4: 7 wikifurries edited TORA
5: 6 wikifurries edited A Furry Future
6: 6 wikifurries edited List of furry convention resources
7: 5 wikifurries edited Furry stereotype
8: 4 wikifurries edited Kero The Wolf (USA)
9: 4 wikifurries edited Furfag
10: 4 wikifurries edited List of media links
11: 4 wikifurries edited List of furry LiveJournal communities
12: 3 wikifurries edited Void folf
13: 3 wikifurries edited Anthro Weekend Utah
14: 3 wikifurries edited Bay Area Furry
15: 3 wikifurries edited Scar
16: 3 wikifurries edited Anthrocon
17: 2 wikifurries edited Pleasure Bon Bon Next
18: 2 wikifurries edited Vanessa Santato
19: 2 wikifurries edited KieroFox
20: 2 wikifurries edited CyaLaterMrG8tor
21: 2 wikifurries edited Ritwells
22: 2 wikifurries edited Marc The Fennec Fox
23: 2 wikifurries edited Huxgamr
24: 2 wikifurries edited Wild Record Collection
25: 2 wikifurries edited The Hampster Dance

ago 2019

1: 12 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Fuzzfest
3: 4 wikifurries edited Timus the Fox
4: 4 wikifurries edited Camaro Cougar
5: 4 wikifurries edited Brasil FurFest
6: 3 wikifurries edited Good Furry Award
7: 3 wikifurries edited Cabincon (UK)
8: 3 wikifurries edited Kaji Taiki
9: 3 wikifurries edited BetaEtaDelota
10: 3 wikifurries edited A Furry Future
11: 3 wikifurries edited SeaGr33nOwl
12: 3 wikifurries edited PyroTheFox
13: 3 wikifurries edited Panda Jenn
14: 3 wikifurries edited Male
15: 3 wikifurries edited Long Island Furs
16: 3 wikifurries edited
17: 3 wikifurries edited Dnapalmhead
18: 3 wikifurries edited List of media links
19: 3 wikifurries edited Megaplex
20: 2 wikifurries edited Serathin
21: 2 wikifurries edited Furry irl subreddit
22: 2 wikifurries edited LIFurs OMGWTFBBQ
23: 2 wikifurries edited Na'Go'Zi
24: 2 wikifurries edited ArtRise
25: 2 wikifurries edited Tigerlilly

set 2019

1: 6 wikifurries edited Jalen Folf
2: 5 wikifurries edited Tails and Tornadoes Fur Con
3: 4 wikifurries edited Fuzzfest
4: 4 wikifurries edited Bariki
5: 3 wikifurries edited Bowser
6: 3 wikifurries edited Blue Ridge Furfare
7: 3 wikifurries edited GFTV News
8: 3 wikifurries edited Pawsry The Wolf
9: 3 wikifurries edited Ahmar Wolf
10: 3 wikifurries edited Azure Paragon
11: 3 wikifurries edited UberQuest
12: 3 wikifurries edited List of fursuit dance competition results
13: 3 wikifurries edited Blizzie
14: 3 wikifurries edited E621
15: 3 wikifurries edited Furry artist
16: 2 wikifurries edited LizardToes
17: 2 wikifurries edited Earthstorm
18: 2 wikifurries edited Splash Kase
19: 2 wikifurries edited OrangeFoxo
20: 2 wikifurries edited Bardelyx
21: 2 wikifurries edited Ego Nightfall
22: 2 wikifurries edited Monkey-Scientist
23: 2 wikifurries edited Koori Kitty
24: 2 wikifurries edited Tails and Tornadoes Fur Con 2019
25: 2 wikifurries edited The Hampster Dance

out 2019

1: 6 wikifurries edited John Remmer
2: 4 wikifurries edited Baby Blu
3: 4 wikifurries edited BadHedgehog
4: 4 wikifurries edited Fur the 'More
5: 4 wikifurries edited List of in-person furry conventions by attendance
6: 3 wikifurries edited Fenris Publishing
7: 3 wikifurries edited
8: 3 wikifurries edited Nikatine
9: 3 wikifurries edited Keziah
10: 3 wikifurries edited Kemono Cafe (web portal)
11: 3 wikifurries edited Confuror
12: 3 wikifurries edited Nicholas Kruger
13: 3 wikifurries edited Kristofur
14: 3 wikifurries edited Lupin Wolfe
15: 2 wikifurries edited Beviraku Xentarex
16: 2 wikifurries edited Mid-Atlantic Anthropomorphic Association, Inc
17: 2 wikifurries edited Howloween 2019
18: 2 wikifurries edited Howloween 2018
19: 2 wikifurries edited Aurawra
20: 2 wikifurries edited Huxgamr
21: 2 wikifurries edited Fernando llacapan
22: 2 wikifurries edited Foxler Nightfire
23: 2 wikifurries edited Raigr Redtail
24: 2 wikifurries edited Brasil FurFest
25: 2 wikifurries edited 4lung

nov 2019

1: 6 wikifurries edited List of in-person furry conventions by attendance
2: 5 wikifurries edited Sheila Vixen
3: 4 wikifurries edited Timeline of media coverage
4: 4 wikifurries edited Ekigyuu
5: 3 wikifurries edited Global Furry Television
6: 3 wikifurries edited Pawsry The Wolf
7: 3 wikifurries edited Baby Blu
8: 3 wikifurries edited Nicholas Kruger
9: 3 wikifurries edited Saph
10: 3 wikifurries edited Howloween
11: 2 wikifurries edited Moji monogG
12: 2 wikifurries edited Furs Upon Malaysia 2018
13: 2 wikifurries edited Furs Upon Malaysia 2015
14: 2 wikifurries edited FloofIRC
15: 2 wikifurries edited Bunniehkins
16: 2 wikifurries edited A very puzzled shark
17: 2 wikifurries edited Rocky Red Panda
18: 2 wikifurries edited Guardians of Dar
19: 2 wikifurries edited Seel (United States)
20: 2 wikifurries edited Rivalo Wolf
21: 2 wikifurries edited FurryJackman
22: 2 wikifurries edited South Mississippi Furry Association
23: 2 wikifurries edited Last Week Tonight with John Oliver
24: 2 wikifurries edited Howloween 2019
25: 2 wikifurries edited Little Island FurCon

dez 2019

1: 7 wikifurries edited Furs Upon Malaysia
2: 5 wikifurries edited Majira Strawberry
3: 4 wikifurries edited Capital City Fur Con
4: 4 wikifurries edited Lupin Wolfe
5: 4 wikifurries edited Sheila Vixen
6: 3 wikifurries edited Furs Upon Malaysia 2019
7: 3 wikifurries edited Little Island Furcon
8: 3 wikifurries edited Nelizar
9: 3 wikifurries edited Brifnar The Bear
10: 3 wikifurries edited Infurnity
11: 3 wikifurries edited Cheetahpaws
12: 3 wikifurries edited Coyo
13: 3 wikifurries edited What's My Name?
14: 3 wikifurries edited Dogbomb
15: 3 wikifurries edited TORA
16: 3 wikifurries edited Fchan
17: 2 wikifurries edited Dasher Skywere
18: 2 wikifurries edited Li Ming the Panda
19: 2 wikifurries edited Revolution FurFest
20: 2 wikifurries edited Soda.pop.pop
21: 2 wikifurries edited Kes The Wolf
22: 2 wikifurries edited CyaLaterMrG8tor
23: 2 wikifurries edited Tyler Furrison
24: 2 wikifurries edited Pawsry The Wolf
25: 2 wikifurries edited BetaEtaDelota

jan 2020

1: 6 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Revolution FurFest
3: 4 wikifurries edited Howlr
4: 3 wikifurries edited Zoosadist Evidence
5: 3 wikifurries edited Jalen Folf
6: 3 wikifurries edited Japan Meeting of Furries
7: 3 wikifurries edited Penguin
8: 3 wikifurries edited Furry stereotype
9: 3 wikifurries edited Fur Affinity
10: 3 wikifurries edited Further Confusion
11: 2 wikifurries edited Tabyhunterwolf
12: 2 wikifurries edited Barry Angel Dragon
13: 2 wikifurries edited FURRY CENTRAL (Russia)
14: 2 wikifurries edited Simba Lion (United Kingdom)
15: 2 wikifurries edited Simba Lion
16: 2 wikifurries edited Lupine Werewolf
17: 2 wikifurries edited Circuit Wolfy
18: 2 wikifurries edited Fishy Tales of the Nekomata
19: 2 wikifurries edited Sirberus Khaos
20: 2 wikifurries edited Etrius vanRandr
21: 2 wikifurries edited Furry Tea Party
22: 2 wikifurries edited Furrymosa
23: 2 wikifurries edited HowlSoup
24: 2 wikifurries edited FurryJoA
25: 2 wikifurries edited Further Confusion 2020

fev 2020

1: 5 wikifurries edited Derrpy The Deer
2: 4 wikifurries edited Reagan Lodge
3: 4 wikifurries edited Dasher Skywere
4: 4 wikifurries edited List of in-person furry conventions by attendance
5: 3 wikifurries edited Arcticina Fox
6: 3 wikifurries edited South East Florida Furs
7: 3 wikifurries edited Etrius vanRandr
8: 3 wikifurries edited South Mississippi Furry Association
9: 3 wikifurries edited ArtworkTee
10: 3 wikifurries edited Kero The Wolf (USA)
11: 3 wikifurries edited Nicholas Kruger
12: 3 wikifurries edited Tyrin
13: 3 wikifurries edited Furry Survey
14: 3 wikifurries edited FurBuy
15: 3 wikifurries edited Fursuit
16: 2 wikifurries edited Kaye
17: 2 wikifurries edited Wadey
18: 2 wikifurries edited Aiko Wolf
19: 2 wikifurries edited AlexanderPaw
20: 2 wikifurries edited Luna Miakoda
21: 2 wikifurries edited Alex Reeder
22: 2 wikifurries edited Haruyuki
23: 2 wikifurries edited MobiFurs
24: 2 wikifurries edited Shelby (Lithuania)
25: 2 wikifurries edited Seel (United States)

mar 2020

1: 11 wikifurries edited COVID-19
2: 7 wikifurries edited Nelizar
3: 5 wikifurries edited LAFF Bowling
4: 4 wikifurries edited Furnal Equinox 2020
5: 3 wikifurries edited Xeno Skolf
6: 3 wikifurries edited Tiz Alo Weymont
7: 3 wikifurries edited Félix Wolf
8: 3 wikifurries edited AmyFoxx
9: 3 wikifurries edited Biohazard
10: 3 wikifurries edited 9/11 Furry Status Page
11: 2 wikifurries edited LockJaw Arts murder
12: 2 wikifurries edited Kontra
13: 2 wikifurries edited Ping Panda
14: 2 wikifurries edited Muzzy
15: 2 wikifurries edited The Voice of Dog
16: 2 wikifurries edited Sebastian The Husky
17: 2 wikifurries edited Sonic the Hedgehog (film)
18: 2 wikifurries edited Otterdance
19: 2 wikifurries edited Oh So Hero!
20: 2 wikifurries edited Nikatine
21: 2 wikifurries edited Zooptoon
22: 2 wikifurries edited AxxiosGrey
23: 2 wikifurries edited Uncovered
24: 2 wikifurries edited Kilinah
25: 2 wikifurries edited Sangie Nativus

abr 2020

1: 12 wikifurries edited COVID-19
2: 6 wikifurries edited Furality Online Xperience
3: 6 wikifurries edited Timeline of media coverage
4: 4 wikifurries edited Barry Angel Dragon
5: 4 wikifurries edited Kero The Wolf (USA)
6: 4 wikifurries edited Majira Strawberry
7: 4 wikifurries edited Raptor
8: 3 wikifurries edited Extracurricular Activities
9: 3 wikifurries edited LockJaw Arts murder
10: 3 wikifurries edited Furry irl subreddit
11: 3 wikifurries edited Siskmarek
12: 3 wikifurries edited Biohazard
13: 3 wikifurries edited E621
14: 3 wikifurries edited Kenket
15: 2 wikifurries edited CozyCon
16: 2 wikifurries edited Lookin' Bright
17: 2 wikifurries edited Vappyvap
18: 2 wikifurries edited Blinky Bill (series)
19: 2 wikifurries edited The Furry Book Review
20: 2 wikifurries edited South & North Fursuit Union
21: 2 wikifurries edited Furality
22: 2 wikifurries edited Circuit Wolfy
23: 2 wikifurries edited Last Week Tonight with John Oliver
24: 2 wikifurries edited Kaji Taiki
25: 2 wikifurries edited Anthrocon 2020

mai 2020

1: 12 wikifurries edited COVID-19
2: 5 wikifurries edited Connor Goodwolf
3: 4 wikifurries edited Gonz
4: 4 wikifurries edited Undertale
5: 4 wikifurries edited Pocari Roo
6: 4 wikifurries edited Fluke Husky
7: 4 wikifurries edited Animal Crossing
8: 4 wikifurries edited Fur Affinity
9: 3 wikifurries edited Zak Wolf
10: 3 wikifurries edited Furry Weekend Atlanta 2020
11: 3 wikifurries edited Amadeus Chaffe
12: 3 wikifurries edited Leon the Fox
13: 3 wikifurries edited Furbooru
14: 3 wikifurries edited List of online furry conventions in 2020
15: 3 wikifurries edited Furality Online Xperience
16: 3 wikifurries edited Kero The Wolf (USA)
17: 3 wikifurries edited SpokAnthro
18: 3 wikifurries edited Lobofeo
19: 3 wikifurries edited Glitch (content creator)
20: 3 wikifurries edited Brasil FurFest
21: 3 wikifurries edited Furs Upon Malaysia
22: 3 wikifurries edited Coyo
23: 3 wikifurries edited Shadowfox8588
24: 3 wikifurries edited E621
25: 3 wikifurries edited Timeline of media coverage

jun 2020

1: 8 wikifurries edited COVID-19
2: 4 wikifurries edited Brifnar The Bear
3: 4 wikifurries edited University of Georgia
4: 3 wikifurries edited Echo (game)
5: 3 wikifurries edited Skye Cirrus
6: 3 wikifurries edited Tekrin
7: 3 wikifurries edited Brasil FurFest
8: 3 wikifurries edited DangerDoberman
9: 3 wikifurries edited Panda Paco
10: 3 wikifurries edited Connor Goodwolf
11: 3 wikifurries edited Dinosaur
12: 3 wikifurries edited Sonic the Hedgehog (franchise)
13: 2 wikifurries edited Little Kaida
14: 2 wikifurries edited Down Home FurCon
15: 2 wikifurries edited Collin G.
16: 2 wikifurries edited Primagen
17: 2 wikifurries edited Sin City Murr Con
18: 2 wikifurries edited Geocaching fur
19: 2 wikifurries edited Hastings County Furries
20: 2 wikifurries edited Sebastian The Husky
21: 2 wikifurries edited Etrius vanRandr
22: 2 wikifurries edited
23: 2 wikifurries edited Brasil FurFest 2020
24: 2 wikifurries edited Capital City Fur Con
25: 2 wikifurries edited Tyler Furrison

jul 2020

1: 7 wikifurries edited COVID-19
2: 6 wikifurries edited Nightmare Bat
3: 6 wikifurries edited Connor Goodwolf
4: 5 wikifurries edited List of online furry conventions in 2020
5: 5 wikifurries edited SoftDiamond
6: 5 wikifurries edited Nicholas Kruger
7: 4 wikifurries edited Megaplex Online
8: 4 wikifurries edited Anthrocon 2020
9: 3 wikifurries edited Hex Furry Fest
10: 3 wikifurries edited Meeran
11: 3 wikifurries edited BetaEtaDelota
12: 3 wikifurries edited Shavano
13: 3 wikifurries edited Majira Strawberry
14: 3 wikifurries edited Hunter DarkWolf
15: 3 wikifurries edited Dog
16: 3 wikifurries edited RainFurrest
17: 2 wikifurries edited SCP-1471
18: 2 wikifurries edited Furry Weekend At-Home
19: 2 wikifurries edited NONSTOP WORLD
20: 2 wikifurries edited List of online furry conventions by attendance
21: 2 wikifurries edited Virtual Anthrocon
22: 2 wikifurries edited Maitre Joker
23: 2 wikifurries edited Brasil FurFest 2021
24: 2 wikifurries edited IndyWolfy
25: 2 wikifurries edited FloofIRC

ago 2020

1: 4 wikifurries edited VRChat
2: 4 wikifurries edited Skippy: Adventures in Bushtown
3: 4 wikifurries edited List of online furry conventions in 2020
4: 4 wikifurries edited Buhha
5: 4 wikifurries edited Raptor
6: 3 wikifurries edited
7: 3 wikifurries edited Kosperry
8: 3 wikifurries edited Odin Wolf
9: 3 wikifurries edited Varka
10: 3 wikifurries edited GNU mascot
11: 3 wikifurries edited Scale (person)
12: 3 wikifurries edited Fur Affinity
13: 2 wikifurries edited Fur-Eh! 2020
14: 2 wikifurries edited Snooganssnoogans
15: 2 wikifurries edited Dart
16: 2 wikifurries edited Techno Blueberry
17: 2 wikifurries edited AnthonyDaFox
18: 2 wikifurries edited Fesothe
19: 2 wikifurries edited Furrydelphia Virtualcon
20: 2 wikifurries edited Scribbled Mutt
21: 2 wikifurries edited FoxTails Furry Literature Webring
22: 2 wikifurries edited Pichuboy
23: 2 wikifurries edited RAMCon
24: 2 wikifurries edited FeralCon
25: 2 wikifurries edited Megaplex 2020

set 2020

1: 6 wikifurries edited Sangie Nativus
2: 4 wikifurries edited List of online furry conventions in 2020
3: 4 wikifurries edited COVID-19
4: 3 wikifurries edited Dasher Skywere
5: 3 wikifurries edited 4lung
6: 3 wikifurries edited Babyfur
7: 2 wikifurries edited AWOO Association
8: 2 wikifurries edited PeaceWolf
9: 2 wikifurries edited PeaceWolf Creations
10: 2 wikifurries edited Ember Kamura
11: 2 wikifurries edited OatmealKitty
12: 2 wikifurries edited Canela the Dolcimostro
13: 2 wikifurries edited STL Furries
14: 2 wikifurries edited UwU
15: 2 wikifurries edited OwO
16: 2 wikifurries edited Stone Mane
17: 2 wikifurries edited Meekah Shepherd
18: 2 wikifurries edited Ozzie Kit Skunk
19: 2 wikifurries edited Hex Furry Fest
20: 2 wikifurries edited Meeran
21: 2 wikifurries edited Barry Angel Dragon
22: 2 wikifurries edited Furry irl subreddit
23: 2 wikifurries edited ArtRise
24: 2 wikifurries edited Kero The Wolf (USA)
25: 2 wikifurries edited Furry Beach Club

out 2020

1: 5 wikifurries edited List of online furry conventions in 2020
2: 4 wikifurries edited Skye Wilde
3: 4 wikifurries edited Jack (webcomic)
4: 3 wikifurries edited DEFCON Furs
5: 3 wikifurries edited Makemeä
6: 3 wikifurries edited Sarivr the Husky
7: 3 wikifurries edited AekoShep
8: 3 wikifurries edited SCP-1471
9: 3 wikifurries edited Meeran
10: 3 wikifurries edited Anthro SouthEast
11: 3 wikifurries edited Furvester
12: 3 wikifurries edited Flüüfff
13: 3 wikifurries edited AquatiFur
14: 3 wikifurries edited Anthro Northwest
15: 3 wikifurries edited Howloween
16: 3 wikifurries edited Kitsune (mythology)
17: 2 wikifurries edited The Energetic Convention
18: 2 wikifurries edited Furry Migration 2019
19: 2 wikifurries edited T.E.C.
20: 2 wikifurries edited YuumaKuma
21: 2 wikifurries edited TsuYagami
22: 2 wikifurries edited Furality Online Xperience
23: 2 wikifurries edited COVID-19
24: 2 wikifurries edited City Fur
25: 2 wikifurries edited Derrpy The Deer

nov 2020

1: 5 wikifurries edited Bearly Furcasting Feat. Taebyn
2: 5 wikifurries edited
3: 4 wikifurries edited Moshi Kodokushi
4: 3 wikifurries edited Bearly Normal
5: 3 wikifurries edited Hayop Ka!
6: 3 wikifurries edited KatoPup
7: 3 wikifurries edited Rayne Raccoon
8: 3 wikifurries edited List of online furry conventions in 2020
9: 3 wikifurries edited AxxiosGrey
10: 3 wikifurries edited Creatures and Creations
11: 3 wikifurries edited Stormy
12: 3 wikifurries edited UberQuest
13: 3 wikifurries edited The GhostPony
14: 3 wikifurries edited Pingu
15: 3 wikifurries edited Skuff Coyote
16: 2 wikifurries edited Space Paws
17: 2 wikifurries edited Bulan Dragon
18: 2 wikifurries edited Sarivr the Husky
19: 2 wikifurries edited Hex Furryfest: Winter Wonderland
20: 2 wikifurries edited Furality Online Xperience
21: 2 wikifurries edited COVID-19
22: 2 wikifurries edited Rusfurrence 2007
23: 2 wikifurries edited Earthstorm
24: 2 wikifurries edited IronFurs
25: 2 wikifurries edited Zillion Ross

dez 2020

1: 4 wikifurries edited Rex Mathison
2: 4 wikifurries edited COVID-19
3: 4 wikifurries edited John Remmer
4: 4 wikifurries edited Changed
5: 4 wikifurries edited Nicholas Kruger
6: 4 wikifurries edited Rahne Kallon
7: 3 wikifurries edited Bearly Furcasting Feat. Taebyn
8: 3 wikifurries edited Mihzo
9: 3 wikifurries edited Sangie Nativus
10: 3 wikifurries edited Cammie
11: 3 wikifurries edited E621
12: 3 wikifurries edited Drake Coalcliff
13: 3 wikifurries edited Kenner
14: 2 wikifurries edited Ras-B
15: 2 wikifurries edited StratosFur
16: 2 wikifurries edited Vibiro Uhlersoth
17: 2 wikifurries edited Nichibotsu
18: 2 wikifurries edited Ferles
19: 2 wikifurries edited Xotz
20: 2 wikifurries edited Beast's Fury
21: 2 wikifurries edited Dragon Snow
22: 2 wikifurries edited Sarivr the Husky
23: 2 wikifurries edited Leon the Fox
24: 2 wikifurries edited Near
25: 2 wikifurries edited Etrius vanRandr

jan 2021

1: 6 wikifurries edited List of online furry conventions in 2021
2: 6 wikifurries edited Iveechan
3: 4 wikifurries edited Online furry convention
4: 4 wikifurries edited List of online furry conventions in 2020
5: 4 wikifurries edited Ryker122
6: 4 wikifurries edited List of furry visual novels
7: 4 wikifurries edited Otto Bluescale
8: 3 wikifurries edited Bolt DMC
9: 3 wikifurries edited List of online furry conventions before March 2020
10: 3 wikifurries edited Foxler Nightfire
11: 3 wikifurries edited Cassidy The Civet
12: 3 wikifurries edited Cammie
13: 3 wikifurries edited Cliff Husky
14: 3 wikifurries edited Bucky Rabbit
15: 3 wikifurries edited Jibba Foxcoon
16: 3 wikifurries edited Skunk
17: 3 wikifurries edited AraKaraath
18: 2 wikifurries edited Bogus Bunny
19: 2 wikifurries edited Eclipse Highroller
20: 2 wikifurries edited VonKarn
21: 2 wikifurries edited Beast's Fury
22: 2 wikifurries edited PeaceWolf
23: 2 wikifurries edited PeaceWolf Creations
24: 2 wikifurries edited LockJaw Arts murder
25: 2 wikifurries edited Blue Ridge Furfare

fev 2021

1: 4 wikifurries edited Don't Hug Cacti
2: 4 wikifurries edited MILFurs
3: 3 wikifurries edited AkeytaDaHyena
4: 3 wikifurries edited FoxRunTime
5: 3 wikifurries edited Coyo
6: 3 wikifurries edited History of Fur Affinity
7: 3 wikifurries edited Diezel Raccoon
8: 3 wikifurries edited Kimba the White Lion
9: 3 wikifurries edited Edd Vick
10: 3 wikifurries edited Fur Affinity
11: 2 wikifurries edited Furgatory
12: 2 wikifurries edited Furgatory (VRChat)
13: 2 wikifurries edited Bearly Furcasting Feat. Taebyn
14: 2 wikifurries edited Gabriel Foxx
15: 2 wikifurries edited Lilo & Stitch
16: 2 wikifurries edited Subwuffer Entertainment
17: 2 wikifurries edited SeaWolf LA1
18: 2 wikifurries edited Zooptoon
19: 2 wikifurries edited Galaxy Town
20: 2 wikifurries edited Snakehead404
21: 2 wikifurries edited Whiley Fox
22: 2 wikifurries edited Jasonafex
23: 2 wikifurries edited El Lince Perdido
24: 2 wikifurries edited Fox Azure
25: 2 wikifurries edited E621

mar 2021

1: 4 wikifurries edited List of online furry conventions in 2021
2: 3 wikifurries edited TsuYagami
3: 3 wikifurries edited VRChat
4: 3 wikifurries edited Viernes Furry
5: 3 wikifurries edited Ryker122
6: 3 wikifurries edited Majira Strawberry
7: 3 wikifurries edited Fudgy Shep
8: 3 wikifurries edited Queer Duck
9: 3 wikifurries edited Zoophilia
10: 2 wikifurries edited Darkus Night
11: 2 wikifurries edited Anthrocon 2021
12: 2 wikifurries edited Kangoo
13: 2 wikifurries edited Evan the husky
14: 2 wikifurries edited Furgatory (VRChat)
15: 2 wikifurries edited Bearly Furcasting Feat. Taebyn
16: 2 wikifurries edited Rubber Dragon Labs
17: 2 wikifurries edited Etrius vanRandr
18: 2 wikifurries edited Fox Danger Piacenti
19: 2 wikifurries edited Koidel Coyote
20: 2 wikifurries edited Kero The Wolf (USA)
21: 2 wikifurries edited Kazuto Nightwolf
22: 2 wikifurries edited SalemtheCruel
23: 2 wikifurries edited Tarnfalk
24: 2 wikifurries edited Trybal Wolf
25: 2 wikifurries edited ZonkPunch

abr 2021

1: 5 wikifurries edited List of online furry conventions in 2021
2: 4 wikifurries edited Violence With/Against Furries
3: 4 wikifurries edited Diezel Raccoon
4: 3 wikifurries edited The Fuzzies
5: 3 wikifurries edited Dobermom
6: 3 wikifurries edited Of Beasts and Men
7: 3 wikifurries edited Horse
8: 2 wikifurries edited Inflates you making you big and round
9: 2 wikifurries edited Mephit Fur Meet 2021
10: 2 wikifurries edited The Furry Fandom Government
11: 2 wikifurries edited Hybrid furry convention
12: 2 wikifurries edited Southern Paws
13: 2 wikifurries edited Void folf
14: 2 wikifurries edited Binghar
15: 2 wikifurries edited Cassidy The Civet
16: 2 wikifurries edited Majira Strawberry
17: 2 wikifurries edited Pacific Anthropomorphics League
18: 2 wikifurries edited PixieWolf
19: 2 wikifurries edited Itsukine
20: 2 wikifurries edited FurDU
21: 2 wikifurries edited Draconicus
22: 2 wikifurries edited The Nostalgia Critic
23: 2 wikifurries edited TerdBurgler
24: 2 wikifurries edited Queer Duck
25: 2 wikifurries edited Nightdancer

mai 2021

1: 6 wikifurries edited Diezel Raccoon
2: 4 wikifurries edited Taebyn Pup
3: 4 wikifurries edited Coyo
4: 3 wikifurries edited Novice
5: 3 wikifurries edited List of online furry conventions in 2021
6: 3 wikifurries edited Ruining the magic
7: 3 wikifurries edited Kothorix
8: 3 wikifurries edited Shinopa Thyme
9: 3 wikifurries edited TORA
10: 3 wikifurries edited Charem
11: 3 wikifurries edited Iveechan
12: 2 wikifurries edited Tangletorn
13: 2 wikifurries edited Bearly Furcasting Feat. Taebyn
14: 2 wikifurries edited Rubber Dragon
15: 2 wikifurries edited Buck Riley
16: 2 wikifurries edited Kaye
17: 2 wikifurries edited Imperial Lands
18: 2 wikifurries edited Barry Angel Dragon
19: 2 wikifurries edited Simba Lion (United Kingdom)
20: 2 wikifurries edited Zoosadist Evidence
21: 2 wikifurries edited Kero The Wolf (USA)
22: 2 wikifurries edited KiraNoot
23: 2 wikifurries edited Gamer Den
24: 2 wikifurries edited MFD
25: 2 wikifurries edited FURReal

jun 2021

1: 6 wikifurries edited Ted Sheppard
2: 5 wikifurries edited Near
3: 4 wikifurries edited Parappa the Rapper
4: 4 wikifurries edited TsuYagami
5: 4 wikifurries edited Itty Bitty Fur Con
6: 4 wikifurries edited Furtastic
7: 3 wikifurries edited Nois Ohm Skunk
8: 3 wikifurries edited Primagen
9: 3 wikifurries edited Stalkaz the Stallion
10: 3 wikifurries edited Good Furry Award
11: 3 wikifurries edited Draconis
12: 3 wikifurries edited Vagrant
13: 3 wikifurries edited There She Is!!
14: 2 wikifurries edited Kyan The Jingly
15: 2 wikifurries edited Wild Nights 2021
16: 2 wikifurries edited Drago Tatsuki
17: 2 wikifurries edited Furventure Games
18: 2 wikifurries edited Lilo & Stitch
19: 2 wikifurries edited StratosFur
20: 2 wikifurries edited Hobkin
21: 2 wikifurries edited VRChat
22: 2 wikifurries edited Furality Online Xperience
23: 2 wikifurries edited Etrius vanRandr
24: 2 wikifurries edited Aurawra
25: 2 wikifurries edited Little Island Furcon

jul 2021

1: 6 wikifurries edited Diezel Raccoon
2: 5 wikifurries edited Nicholas Kruger
3: 5 wikifurries edited Kemono
4: 4 wikifurries edited Reddit
5: 4 wikifurries edited Furtastic
6: 4 wikifurries edited Cub
7: 4 wikifurries edited Encyclopædia Dramatica
8: 4 wikifurries edited 4chan
9: 3 wikifurries edited Foxycfreezy
10: 3 wikifurries edited Sparkie the wolf
11: 3 wikifurries edited StratosFur
12: 3 wikifurries edited TsuYagami
13: 3 wikifurries edited SCP-1471
14: 3 wikifurries edited Austin Furry Burlesque
15: 3 wikifurries edited Wisconsin Wilderness Campout
16: 3 wikifurries edited Furrydelphia
17: 3 wikifurries edited Furry Siesta
18: 3 wikifurries edited Luke
19: 3 wikifurries edited Furry Migration
20: 3 wikifurries edited WikiFur
21: 3 wikifurries edited Drake Coalcliff
22: 3 wikifurries edited Gay Yiffy Club
23: 3 wikifurries edited Megaplex
24: 3 wikifurries edited Furry code
25: 3 wikifurries edited Wolf

ago 2021

1: 8 wikifurries edited TsuYagami
2: 6 wikifurries edited Nicholas Kruger
3: 5 wikifurries edited The Lion Guard
4: 5 wikifurries edited G-Force
5: 5 wikifurries edited Inkbunny
6: 4 wikifurries edited Derrpy The Deer
7: 4 wikifurries edited Yiff Lounge
8: 4 wikifurries edited MinetteFraise
9: 4 wikifurries edited Yiff
10: 3 wikifurries edited Smaiello93
11: 3 wikifurries edited Firon Draak
12: 3 wikifurries edited Rex Kitsune
13: 3 wikifurries edited Ortaon
14: 3 wikifurries edited MysteryMan69
15: 3 wikifurries edited Gill Panda
16: 3 wikifurries edited Kitchiki
17: 3 wikifurries edited Etrius vanRandr
18: 3 wikifurries edited BetaEtaDelota
19: 3 wikifurries edited Zolar
20: 3 wikifurries edited Nanukk Luik
21: 2 wikifurries edited Lander Foxx
22: 2 wikifurries edited Axel Doberman
23: 2 wikifurries edited Makucha
24: 2 wikifurries edited Chuluun
25: 2 wikifurries edited Lambox

set 2021

1: 6 wikifurries edited TsuYagami
2: 6 wikifurries edited Félix Wolf
3: 5 wikifurries edited Claimoar
4: 5 wikifurries edited Free Fur All
5: 4 wikifurries edited Phantom
6: 4 wikifurries edited Keishinkae
7: 4 wikifurries edited Jaylacine Chiboa
8: 4 wikifurries edited AusiDogChance
9: 4 wikifurries edited Zenith Wolf
10: 4 wikifurries edited Sincerity
11: 4 wikifurries edited COVID-19
12: 4 wikifurries edited Melvis Barksy
13: 3 wikifurries edited Fox Arvid
14: 3 wikifurries edited Damon Laseur
15: 3 wikifurries edited JayFri
16: 3 wikifurries edited Enric The Penguin
17: 3 wikifurries edited Yoshi The Fox
18: 3 wikifurries edited Comet The Wolf
19: 3 wikifurries edited Joel The Lemur
20: 3 wikifurries edited Shay (writer)
21: 3 wikifurries edited Tarrynt
22: 3 wikifurries edited Avro Lynx
23: 3 wikifurries edited Shiloh Skye
24: 3 wikifurries edited Jet der Hund
25: 3 wikifurries edited Duke Rocheister

out 2021

1: 16 wikifurries edited Kemoket
2: 8 wikifurries edited Alamo City Furry Invasion
3: 5 wikifurries edited Motor City Furry Con
4: 4 wikifurries edited Meebo Manx
5: 4 wikifurries edited Sparkie the wolf
6: 4 wikifurries edited Majira Strawberry
7: 3 wikifurries edited Sb Heuixis
8: 3 wikifurries edited OwO
9: 3 wikifurries edited Coco Rapidpaws
10: 3 wikifurries edited Hazard (United Kingdom)
11: 2 wikifurries edited ConFurence 8 elevator incident
12: 2 wikifurries edited Manedwolfy
13: 2 wikifurries edited Rags Wolfsky
14: 2 wikifurries edited SagaDreams
15: 2 wikifurries edited Stuggottzz
16: 2 wikifurries edited Peppy Squirrel
17: 2 wikifurries edited Original species
18: 2 wikifurries edited Mephit Fur Meet 2021
19: 2 wikifurries edited Cathee
20: 2 wikifurries edited Bearly Furcasting Feat. Taebyn
21: 2 wikifurries edited Primagen
22: 2 wikifurries edited Etrius vanRandr
23: 2 wikifurries edited Golden State Fur Con
24: 2 wikifurries edited VancouFur 2020
25: 2 wikifurries edited FurryPinas

nov 2021

1: 7 wikifurries edited Lycangel
2: 6 wikifurries edited Zorak
3: 5 wikifurries edited Sparkie the wolf
4: 5 wikifurries edited The Bolt Chronicles
5: 4 wikifurries edited Erin NorthStar
6: 4 wikifurries edited List of online furry conventions in 2021
7: 4 wikifurries edited Furry stereotype
8: 3 wikifurries edited The Energetic Convention
9: 3 wikifurries edited CycoMa1
10: 3 wikifurries edited Free Fur All
11: 3 wikifurries edited AWOO Association
12: 3 wikifurries edited Voiced Otter
13: 3 wikifurries edited Kovuah
14: 3 wikifurries edited Buhha
15: 3 wikifurries edited Toyhouse
16: 3 wikifurries edited The Dealers Den
17: 3 wikifurries edited Madagascar (characters, penguins)
18: 3 wikifurries edited Koalakitty23
19: 3 wikifurries edited Alex Rian
20: 3 wikifurries edited Israeli Furs
21: 3 wikifurries edited Christian Fur
22: 3 wikifurries edited Scalie
23: 2 wikifurries edited Nexus (fursuiter)
24: 2 wikifurries edited Toucan Sam
25: 2 wikifurries edited Confuror 2021

dez 2021

1: 4 wikifurries edited VRChat
2: 3 wikifurries edited Sparkie the wolf
3: 3 wikifurries edited List of online furry conventions in 2021
4: 3 wikifurries edited Michele Gault
5: 3 wikifurries edited Beeps
6: 3 wikifurries edited Mary Hanson-Roberts
7: 3 wikifurries edited Bob M. Guthrie
8: 3 wikifurries edited GreenReaper
9: 2 wikifurries edited Floof Con
10: 2 wikifurries edited How This All Happened
11: 2 wikifurries edited Cam
12: 2 wikifurries edited Alterhuman
13: 2 wikifurries edited Mihzo
14: 2 wikifurries edited COVID-19
15: 2 wikifurries edited Derrpy The Deer
16: 2 wikifurries edited Kazuto Nightwolf
17: 2 wikifurries edited Furry.FM
18: 2 wikifurries edited AlphaScout
19: 2 wikifurries edited Alastair
20: 2 wikifurries edited Grubbs Grizzly
21: 2 wikifurries edited Hunter Demonwuff
22: 2 wikifurries edited Genitalia
23: 2 wikifurries edited Furr Happens
24: 1 wikifurries edited Equiali

jan 2022

1: 4 wikifurries edited List of in-person furry conventions by attendance
2: 3 wikifurries edited BIPOC Fur Hangout
3: 3 wikifurries edited List of online furry conventions
4: 3 wikifurries edited Sparkie the wolf
5: 3 wikifurries edited AnthroExpo
6: 3 wikifurries edited Marcus
7: 3 wikifurries edited Mirelmture
8: 3 wikifurries edited Dog
9: 3 wikifurries edited Timeline of media coverage
10: 3 wikifurries edited Bay Area Furry
11: 2 wikifurries edited Ash Coyote
12: 2 wikifurries edited Tirox
13: 2 wikifurries edited Fossa (species)
14: 2 wikifurries edited Mary Bellamy
15: 2 wikifurries edited Keys
16: 2 wikifurries edited Scalie Bloke
17: 2 wikifurries edited Rex Mathison
18: 2 wikifurries edited Alterhuman
19: 2 wikifurries edited COVID-19
20: 2 wikifurries edited Wild Times
21: 2 wikifurries edited Kiwi Fox
22: 2 wikifurries edited Antumbra
23: 2 wikifurries edited Inuzoribu (Dogsled Club)
24: 2 wikifurries edited AJ Shepherd
25: 2 wikifurries edited Zootopia

fev 2022

1: 5 wikifurries edited Sparkie the wolf
2: 5 wikifurries edited Corgi Events
3: 4 wikifurries edited Kyo Foxtrot
4: 3 wikifurries edited JFETspeaks
5: 3 wikifurries edited Howlr
6: 3 wikifurries edited Symbiote
7: 3 wikifurries edited Frocta
8: 3 wikifurries edited FurJAM
9: 2 wikifurries edited Polybun
10: 2 wikifurries edited Nakiri
11: 2 wikifurries edited Jhon the wolf
12: 2 wikifurries edited DeeJaay The Folfsky
13: 2 wikifurries edited Burlington
14: 2 wikifurries edited List of online furry conventions
15: 2 wikifurries edited KanutWolfen
16: 2 wikifurries edited Anthro New England 2022
17: 2 wikifurries edited Dragon Snow
18: 2 wikifurries edited Furality Online Xperience
19: 2 wikifurries edited Kiwi Fox
20: 2 wikifurries edited Adam Thomas Applebaum
21: 2 wikifurries edited Sprrigs
22: 2 wikifurries edited Pochi
23: 2 wikifurries edited Lemonade Coyote
24: 2 wikifurries edited Pepper Coyote
25: 2 wikifurries edited 3aek

mar 2022

1: 6 wikifurries edited Sparkie the wolf
2: 4 wikifurries edited Rex Mathison
3: 4 wikifurries edited Tom and Jerry
4: 4 wikifurries edited Symbiote
5: 4 wikifurries edited CynWolfe
6: 3 wikifurries edited Zonkpunch
7: 3 wikifurries edited List of online furry conventions
8: 3 wikifurries edited Aggretsuko
9: 3 wikifurries edited VancouFur
10: 3 wikifurries edited MitoFox
11: 3 wikifurries edited E621
12: 2 wikifurries edited Kobold Northcote
13: 2 wikifurries edited Beastars
14: 2 wikifurries edited Jayden Tacoma
15: 2 wikifurries edited Fluffy & The Beast
16: 2 wikifurries edited Woods Flock
17: 2 wikifurries edited Wolf Butler And His Cat Master
18: 2 wikifurries edited The Acorn Among Nuts
19: 2 wikifurries edited The Angel in the Forest
20: 2 wikifurries edited Pixie and Brutus
21: 2 wikifurries edited My Dragon Girlfriend
22: 2 wikifurries edited Lost Domain
23: 2 wikifurries edited DomestiCats
24: 2 wikifurries edited Adventures of Topper and Trout
25: 2 wikifurries edited FoxxyFurends

abr 2022

1: 15 wikifurries edited Spider-Ham
2: 5 wikifurries edited Sparkie the wolf
3: 4 wikifurries edited Dexter V. K. Freisen
4: 4 wikifurries edited Dragoneer
5: 3 wikifurries edited Pyxe
6: 3 wikifurries edited CycoMa1
7: 3 wikifurries edited Meeran
8: 3 wikifurries edited Symbiote
9: 3 wikifurries edited Saph
10: 3 wikifurries edited Pit bull
11: 3 wikifurries edited Lemnius Gryphs
12: 3 wikifurries edited Rocko's Modern Life
13: 3 wikifurries edited Sabrina
14: 2 wikifurries edited Luhrak
15: 2 wikifurries edited Furteca
16: 2 wikifurries edited Pigsnout
17: 2 wikifurries edited Hornbuckle (New England)
18: 2 wikifurries edited VancouFur 2022
19: 2 wikifurries edited Erin NorthStar
20: 2 wikifurries edited Original species
21: 2 wikifurries edited Parappa the Rapper
22: 2 wikifurries edited Kennyoung
23: 2 wikifurries edited Cathee
24: 2 wikifurries edited StratosFur
25: 2 wikifurries edited Dragon Snow

mai 2022

1: 12 wikifurries edited Spider-Ham
2: 6 wikifurries edited Fish
3: 6 wikifurries edited Macro
4: 5 wikifurries edited TwilightSaint
5: 5 wikifurries edited Nicholas Kruger
6: 4 wikifurries edited Sparkie the wolf
7: 4 wikifurries edited StratosFur
8: 4 wikifurries edited Wolvinny
9: 4 wikifurries edited Lolo Fennec
10: 4 wikifurries edited Smokey Bear
11: 4 wikifurries edited Werewolf
12: 3 wikifurries edited Pigsnout
13: 3 wikifurries edited Cornwall Furs
14: 3 wikifurries edited Matty Collie
15: 3 wikifurries edited Saph
16: 3 wikifurries edited List of in-person furry conventions by attendance
17: 3 wikifurries edited Brother Bear
18: 2 wikifurries edited Toontown: Corporate Clash
19: 2 wikifurries edited Sheldon Brisby
20: 2 wikifurries edited 2021 Ursa Major Awards
21: 2 wikifurries edited The
22: 2 wikifurries edited Siev
23: 2 wikifurries edited Ten Thousand Miles Up
24: 2 wikifurries edited Tumaini
25: 2 wikifurries edited Thrasher

jun 2022

1: 7 wikifurries edited Symbiote
2: 7 wikifurries edited List of in-person furry conventions by attendance
3: 6 wikifurries edited Zaro Wolf
4: 5 wikifurries edited Furality Online Xperience
5: 5 wikifurries edited Donkey
6: 5 wikifurries edited Primate
7: 5 wikifurries edited Spider-Ham
8: 4 wikifurries edited Rex Mathison
9: 4 wikifurries edited Near
10: 4 wikifurries edited El Gato (mascot)
11: 4 wikifurries edited Inflation
12: 4 wikifurries edited List of media links
13: 4 wikifurries edited List of furry LiveJournal communities
14: 3 wikifurries edited Hornbuckle (New England)
15: 3 wikifurries edited List of online furry conventions
16: 3 wikifurries edited TsuYagami
17: 3 wikifurries edited CozyCon
18: 3 wikifurries edited Crescent Zeal
19: 3 wikifurries edited Fenella \"Fen\" Damour
20: 3 wikifurries edited IKerochu
21: 3 wikifurries edited Transmission
22: 3 wikifurries edited Blitz Wolfang
23: 3 wikifurries edited Genesis Supernova
24: 3 wikifurries edited Hitoshi Funato
25: 3 wikifurries edited D.L. Leonine

jul 2022

1: 7 wikifurries edited Adam Shilo Bear
2: 6 wikifurries edited List of in-person furry conventions by attendance
3: 5 wikifurries edited Hideki
4: 4 wikifurries edited Brasil FurFest
5: 4 wikifurries edited EAST
6: 4 wikifurries edited Midwest FurFest
7: 4 wikifurries edited Anthrocon
8: 3 wikifurries edited Scalie Bloke
9: 3 wikifurries edited Nexus (fursuiter)
10: 3 wikifurries edited StratosFur
11: 3 wikifurries edited Wisconsin Wilderness Campout
12: 3 wikifurries edited Furry BlackLight
13: 3 wikifurries edited Confuror
14: 3 wikifurries edited Big Sky Camp Paw
15: 3 wikifurries edited Anthro Weekend Utah
16: 3 wikifurries edited Furpocalypse
17: 3 wikifurries edited Biggest Little Fur Con
18: 3 wikifurries edited Gay Furry Club
19: 3 wikifurries edited Momo (artist)
20: 3 wikifurries edited Spider-Ham
21: 3 wikifurries edited Western Pennsylvania Furry Weekend
22: 3 wikifurries edited Furry Fiesta
23: 3 wikifurries edited LondonFurs
24: 3 wikifurries edited Character
25: 2 wikifurries edited Cani Lupine

ago 2022

1: 8 wikifurries edited List of in-person furry conventions by attendance
2: 4 wikifurries edited Coltyn
3: 4 wikifurries edited Water
4: 3 wikifurries edited Tommy Kitty
5: 3 wikifurries edited SuperBabsy123
6: 3 wikifurries edited Oso Alex
7: 3 wikifurries edited Pepper Coyote
8: 3 wikifurries edited Rioaka
9: 3 wikifurries edited Wendell Washer
10: 2 wikifurries edited Filth The Mutt
11: 2 wikifurries edited Halfworlder
12: 2 wikifurries edited ChocoShake
13: 2 wikifurries edited FictionBoi
14: 2 wikifurries edited Top Dogs
15: 2 wikifurries edited Slumbertown
16: 2 wikifurries edited Cani Lupine
17: 2 wikifurries edited ChronoWolf
18: 2 wikifurries edited ShadyVox
19: 2 wikifurries edited Scratch21
20: 2 wikifurries edited Wüffus
21: 2 wikifurries edited Manedwolfy
22: 2 wikifurries edited Sb Heuixis
23: 2 wikifurries edited Kennyoung
24: 2 wikifurries edited Hypi
25: 2 wikifurries edited Frankie X

set 2022

1: 5 wikifurries edited Las Vegas Fur Con
2: 4 wikifurries edited SunTattooWolf
3: 4 wikifurries edited JJ Husky
4: 4 wikifurries edited List of in-person furry conventions by attendance
5: 3 wikifurries edited The Den (Canada)
6: 3 wikifurries edited Valleygirl
7: 3 wikifurries edited Thunzeest Wolf
8: 3 wikifurries edited Halfworlder
9: 3 wikifurries edited SurviFur
10: 3 wikifurries edited Sparkie the wolf
11: 3 wikifurries edited Near
12: 3 wikifurries edited Synth (furry artist)
13: 3 wikifurries edited MushyMutt
14: 3 wikifurries edited Arxl
15: 3 wikifurries edited Ychan
16: 3 wikifurries edited Bally
17: 3 wikifurries edited Spider-Ham
18: 3 wikifurries edited Zoophilia
19: 2 wikifurries edited Ghuraok
20: 2 wikifurries edited Retehi
21: 2 wikifurries edited Beeton
22: 2 wikifurries edited Alzurana
23: 2 wikifurries edited EZDBud
24: 2 wikifurries edited PhiliFur
25: 2 wikifurries edited Paeonia Pig

out 2022

1: 1 wikifurries edited Charizard Sparky

Estatísticas geradas em Sábado, 1 de outubro 2022 from recent database dump files.
Data processed up to Sexta-feira, 30 de setembro 2022
This script has been developed for Wikimedia and adapted for WikiFur.
Versão do script:2.3b
Autor:Erik Zachte (Sítio web)

WikiFur site administrator Laurence 'GreenReaper' Parry