WikiFur Statistics



DataWikifurriesArtigosBase de dadosLigações
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
fev 2021    0%0%      +1%+1%0%0%0%0%0%
abr 16, 202113   1,8 k1,8 k 7,0307193%64%26,8 Mb882 k27 k2,2 k1,8 k4,3 k1,4 k
abr 2021 ± 13    ± 1,8 k ± 1,8 k  ± 7,0 ± 3071 ± 93% ± 64% ± 4   ± 27 k ± 2,2 k ± 1,8 k ± 4,3 k ± 1,4 k
mar 202113   1,8 k1,8 k 7,0307893%64% 6,8 Mb883 k27 k2,2 k1,8 k4,3 k1,4 k
fev 202113   1,8 k1,8 k 7,0307893%64%176,8 Mb883 k27 k2,2 k1,8 k4,3 k1,4 k
jan 202113   1,8 k1,8 k 6,9304893%64% 6,8 Mb876 k27 k2,2 k1,8 k4,3 k1,4 k
dez 202013   1,8 k1,8 k 6,9304893%64%66,8 Mb876 k27 k2,2 k1,8 k4,3 k1,4 k
nov 202013   1,8 k1,8 k 6,9304893%65%26,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
out 202013   1,8 k1,8 k 6,9304793%65%56,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
set 202013   1,8 k1,8 k 6,9304793%65%116,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
ago 202013   1,8 k1,8 k 6,9305093%65%26,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
jul 202013 1 1,8 k1,8 k 6,9305093%65%306,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
jun 202013   1,8 k1,8 k 6,9305093%65% 6,8 Mb876 k27 k2,2 k1,8 k4,3 k1,4 k
mai 202013   1,8 k1,8 k 6,9305093%65%26,8 Mb876 k27 k2,2 k1,8 k4,3 k1,4 k
abr 202013   1,8 k1,8 k 6,9305093%65%96,8 Mb876 k27 k2,2 k1,8 k4,3 k1,4 k
mar 202013   1,8 k1,8 k 6,9304893%65% 6,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
fev 202013   1,8 k1,8 k 6,9304893%65%16,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
jan 202013   1,8 k1,8 k 6,9304893%65%26,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
dez 201913   1,8 k1,8 k 6,9304893%65%26,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
nov 201913   1,8 k1,8 k 6,9304793%65%66,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
out 201913   1,8 k1,8 k 6,9304793%65%76,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
set 201913   1,8 k1,8 k 6,9304893%65%26,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
ago 201913   1,8 k1,8 k 6,9304893%65%86,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
jul 201913   1,8 k1,8 k 6,9304893%65%66,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
jun 201913   1,8 k1,8 k 6,9304893%65%46,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
mai 201913   1,8 k1,8 k 6,9304893%65%86,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
abr 201913   1,8 k1,8 k 6,9304793%65%76,8 Mb877 k27 k2,2 k1,8 k4,3 k1,4 k
mar 20191325 1,8 k1,8 k16,9304693%65%616,8 Mb876 k27 k2,2 k1,8 k4,3 k1,4 k
fev 201911   1,8 k1,7 k 6,9292293%65%36,4 Mb826 k25 k2,1 k1,8 k4,1 k1,4 k
jan 201911   1,8 k1,7 k 7,0292193%64%106,4 Mb826 k25 k2,1 k1,8 k4,1 k1,4 k
dez 201811   1,8 k1,7 k 6,9292093%64%116,4 Mb826 k25 k2,1 k1,8 k4,1 k1,4 k
nov 201811   1,8 k1,7 k 6,9291393%64%16,4 Mb823 k25 k2,1 k1,8 k4,1 k1,4 k
out 201811   1,8 k1,7 k 6,9291393%64%36,4 Mb823 k25 k2,1 k1,8 k4,1 k1,4 k
set 201811   1,8 k1,7 k 6,9291393%64%106,4 Mb823 k25 k2,1 k1,8 k4,1 k1,4 k
ago 201811   1,8 k1,7 k 6,9291393%64%136,4 Mb823 k25 k2,1 k1,8 k4,1 k1,4 k
jul 201811   1,8 k1,7 k 6,9290793%64%106,4 Mb822 k25 k2,1 k1,8 k4,1 k1,4 k
jun 201811   1,8 k1,7 k 6,9290693%64%46,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
mai 201811   1,8 k1,7 k 6,9290593%64% 6,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
abr 201811   1,8 k1,7 k 6,9290593%64% 6,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
mar 201811   1,8 k1,7 k 6,9290593%64%16,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
fev 201811   1,8 k1,7 k 6,9290593%64%66,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
jan 201811   1,8 k1,7 k 6,9290593%64%236,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
dez 201711   1,8 k1,7 k 6,9290393%64%56,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
nov 201711 1 1,8 k1,7 k 6,9290393%64%116,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
out 201711   1,8 k1,7 k 6,9290293%64%106,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
set 201711   1,8 k1,7 k 6,9290093%64%36,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
ago 201711   1,8 k1,7 k 6,9290093%64%16,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
jul 201711   1,8 k1,7 k 6,9290093%64%126,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
jun 201711   1,8 k1,7 k 6,9289593%64%56,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
mai 201711   1,8 k1,7 k 6,9289593%64%386,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
abr 201711   1,8 k1,7 k 6,9289393%64%96,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
mar 20171111 1,8 k1,7 k 6,8289393%64%256,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
fev 201710   1,8 k1,7 k 6,8289293%64%136,4 Mb817 k25 k2,1 k1,8 k4,1 k1,4 k
jan 201710   1,8 k1,7 k 6,8289293%64%76,4 Mb817 k25 k2,1 k1,8 k4,1 k1,4 k
dez 20161012 1,8 k1,7 k 6,8289293%64%166,4 Mb817 k25 k2,1 k1,8 k4,1 k1,4 k
nov 20169 1 1,8 k1,7 k 6,8289193%64%136,3 Mb816 k25 k2,1 k1,8 k4,1 k1,4 k
out 20169 2 1,8 k1,7 k 6,8289193%64%536,3 Mb816 k25 k2,1 k1,8 k4,1 k1,4 k
set 20169 1 1,8 k1,7 k 6,8289093%64%206,3 Mb813 k25 k2,1 k1,8 k4,1 k1,4 k
ago 20169 2 1,8 k1,7 k 6,8289093%64%576,3 Mb812 k25 k2,1 k1,8 k4,1 k1,4 k
jul 20169 1 1,8 k1,7 k 6,8289093%64%326,3 Mb810 k25 k2,1 k1,8 k4,1 k1,4 k
jun 20169 2 1,8 k1,7 k 6,8290094%65%456,3 Mb809 k25 k2,1 k1,8 k4,1 k1,4 k
mai 2016912 1,8 k1,7 k 6,8289894%65%326,3 Mb809 k25 k2,1 k1,8 k4,1 k1,4 k
abr 20168 1 1,8 k1,7 k 6,8289894%65%906,3 Mb808 k25 k2,1 k1,8 k4,1 k1,4 k
mar 20168 3 1,8 k1,7 k 6,7289194%65%376,3 Mb806 k25 k2,1 k1,8 k4,1 k1,4 k
fev 20168 2 1,7 k1,7 k16,7289094%65%1456,2 Mb802 k25 k2,1 k1,8 k4,0 k1,4 k
jan 20168 2 1,7 k1,7 k16,8289094%64%1006,1 Mb784 k25 k2,1 k1,7 k3,8 k1,3 k
dez 20158 211,7 k1,6 k26,8288494%64%2746,0 Mb771 k24 k2,1 k1,7 k3,7 k1,3 k
nov 20158 211,6 k1,6 k16,9286793%64%4025,7 Mb739 k23 k2,1 k1,6 k3,5 k1,2 k
out 20158 221,6 k1,5 k36,8284194%64%8665,5 Mb714 k23 k2,1 k1,6 k3,3 k1,2 k
set 20158 211,5 k1,5 k46,7284194%64%1,0 k5,1 Mb673 k21 k2,0 k1,5 k3,0 k1,1 k
ago 20158 111,4 k1,3 k16,5274294%64%2914,6 Mb599 k20 k2,0 k1,4 k2,6 k930
jul 201581211,3 k1,3 k16,5272394%63%5434,4 Mb576 k19 k1,9 k1,4 k2,5 k845
jun 20157 111,3 k1,3 k26,2272994%63%2544,3 Mb569 k19 k1,9 k1,4 k2,4 k830
mai 20157 1 1,3 k1,2 k 6,2272994%63%484,2 Mb548 k18 k1,9 k1,3 k2,3 k748
abr 2015712 1,3 k1,2 k16,2273694%64%1034,1 Mb545 k18 k1,8 k1,3 k2,3 k726
mar 20156 111,2 k1,2 k16,2272794%63%8614,1 Mb536 k18 k1,8 k1,3 k2,2 k693
fev 20156 111,2 k1,2 k25,8270994%63%2043,9 Mb513 k17 k1,7 k1,2 k2,1 k634
jan 20156 111,1 k1,1 k35,9268094%62%4263,6 Mb483 k16 k1,6 k1,2 k1,9 k593
dez 20146 211,1 k1,0 k35,9269894%62%3703,4 Mb452 k15 k1,4 k1,1 k1,7 k517
nov 2014611197494846,0268393%62%4023,1 Mb416 k13 k1,3 k1,0 k1,5 k478
out 20145 1185082656,4263993%61%1,4 k2,7 Mb358 k11 k1,1 k9051,3 k433
set 20145 2170869035,8263695%59%5232,2 Mb298 k8,3 k1,0 k7811,1 k379
ago 20145   605592 5,9274395%63%11,9 Mb265 k6,9 k9266881,0 k334
jul 20145   605592 5,9274395%63%11,9 Mb265 k6,9 k9266881,0 k334
jun 20145   605592 5,9274395%63%11,9 Mb265 k6,9 k9266881,0 k334
mai 20145   605592 5,9274295%63%11,9 Mb265 k6,9 k9266881,0 k334
abr 20145   605592 5,9274295%63%11,9 Mb265 k6,9 k9266881,0 k334
mar 20145 1 605592 5,9274295%63%141,9 Mb265 k6,9 k9256881,0 k334
fev 20145   605592 5,9274295%63%61,9 Mb265 k6,9 k9176881,0 k334
jan 20145   604591 5,9273995%63%61,9 Mb264 k6,9 k917688982334
dez 20135   604591 5,9273995%63%41,9 Mb264 k6,9 k917688982334
nov 20135 1 604591 5,9273995%63%191,9 Mb264 k6,9 k917688982334
out 20135 2160459125,8273895%63%5731,9 Mb264 k6,8 k917688982332
set 20135 1154453315,4279096%62%1431,8 Mb242 k5,6 k881639928275
ago 20135 1 50949815,5276495%60%601,6 Mb225 k5,1 k823591881266
jul 20135 1148147015,7278795%59%4631,6 Mb215 k4,7 k780537866258
jun 20135 1146545524,9284895%60%2591,5 Mb213 k4,2 k772525837234
mai 20135 1141040214,9278295%58%1531,3 Mb183 k3,3 k706463736203
abr 20135 2137236525,0276595%55%2561,2 Mb165 k3,2 k649475700184
mar 2013512130129635,4258295%52%334917 kb125 k2,1 k568322585139
fev 20134 1 20520316,3260995%50%144627 kb86 k1,5 k51122643060
jan 20134 3116416337,0261695%48%345502 kb69 k1,2 k49718035537
dez 20124 21868629,2244491%38%342244 kb34 k5093318916212
nov 20124 2 3636 12,6370994%53%109157 kb21 k294103441243
out 201241213029 11,5337093%43%162139 kb16 k32896361153
set 20123   2423 7,6252792%25%273 kb9,3 k3309519923
ago 20123   2423 7,5252792%25%173 kb9,3 k3309419923
jul 20123   2424 7,5253492%25% 73 kb9,4 k3309419933
jun 20123   2424 7,5253492%25% 73 kb9,4 k3309419933
mai 20123   2424 7,5253492%25%273 kb9,4 k3309419933
abr 20123   2323 7,7257391%26%371 kb9,1 k3089318913
mar 20123   2222 7,9262491%27%170 kb8,9 k3049017903
fev 20123   2222 7,9268891%32% 71 kb9,1 k3109217903
jan 20123   2222 7,9268891%32%271 kb9,1 k3109217903
dez 20113   2222 7,8268991%32%471 kb9,1 k3119117903
nov 20113   2221 7,6268191%32%471 kb9,1 k3119117893
out 20113   2221 7,4268191%32%371 kb9,1 k3119117893
set 20113   2221 7,3268491%32%271 kb9,1 k3119017873
ago 20113   2221 7,2268191%32%171 kb9,1 k3119017893
jul 20113   2221 7,1268191%32%371 kb9,1 k3118917893
jun 20113   2221 7,0268191%32%471 kb9,1 k3118617893
mai 20113   2221 6,8268191%32%371 kb9,1 k3118417893
abr 20113   2221 6,7266186%32%370 kb9,0 k3118217893
mar 20113   2221 6,5266186%32% 70 kb9,0 k3118117893
fev 20113   2221 6,5266186%32%270 kb9,0 k3118117893
jan 20113   2221 6,5266086%32% 70 kb9,0 k3118117883
dez 20103   2221 6,5266086%32%270 kb9,0 k3118117883
nov 20103   2221 6,4265886%32% 70 kb9,0 k3108117873
out 20103   2221 6,4265886%32%270 kb9,0 k3108117873
set 20103   2120 6,6271186%33% 68 kb8,7 k3068016833
ago 20103   2120 6,6271186%33%268 kb8,7 k3068016833
jul 20103   2120 6,5271186%33%468 kb8,7 k3068016833
jun 20103   2019 6,6283090%35%168 kb8,7 k3048015813
mai 2010311 2019 6,5282490%35%2268 kb8,7 k3048015773
abr 20102   1716 6,4318288%41% 65 kb8,3 k2977713753
mar 20102   1716 6,4318288%41% 65 kb8,3 k2977713753
fev 20102   1716 6,4318288%41%365 kb8,3 k2977713753
jan 20102   1716 6,2318288%41%165 kb8,3 k2977413753
dez 20092   1716 6,2318288%41%365 kb8,3 k2977313753
nov 20092   1716 6,0317888%41% 65 kb8,2 k2977113753
out 20092 1 1716 6,0317888%41%665 kb8,2 k2977113753
set 20092   1716 5,6317688%41% 65 kb8,2 k2966613753
ago 20092   1716 5,6317688%41%365 kb8,2 k2966613753
jul 20092   1716 5,5317788%41%165 kb8,2 k2966413753
jun 20092   1716 5,4317788%41%565 kb8,2 k2966313753
mai 2009222 171615,1317188%41%8764 kb8,2 k2966013753
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikifurriesArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikifurries (usuários registrados)
A = Wikifurries que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikifurries que editaram pelo menos dez vezes desde que chegaram
C = Wikifurries que contribuíram cinco vezes ou mais este mês
D = Wikifurries que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total number of links to WikiFur sites in other languages
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento

1 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

UsuárioEdiçõesPrimeira ediçãoúltima edição
ReaperBot188jun 05, 20094333abr 18, 20142555


20 wikifurries recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.

UsuárioEdiçõesPrimeira ediçãoúltima edição
Valery91Thunder19753out 28, 20123092out 15, 20161644
Gringo2556jul 22, 20152094fev 19, 20171516
Escofal3276mai 07, 20103997set 18, 20161671
DonatoToon484mai 19, 20161793jul 07, 2020283
Ylon569mai 04, 20094365mai 14, 20094355
GreenReaper652mai 02, 20094366abr 10, 2019737
Contix719mar 08, 20132961out 06, 20132749
2A02:C7F:C8B:7500:347D:DAD0:B480:F2A3818mar 02, 2019776mar 02, 2019776
BearInMind914abr 19, 20152189abr 19, 20152189
ReggaeCyp1011nov 22, 20142337abr 29, 2020352
Arvo1111mar 18, 20171490mar 20, 20171488
Furizon1210dez 01, 20161597jan 11, 20181190
2A02:C7F:C8B:7500:4C50:BA77:43DC:82411310mar 01, 2019777mar 01, 2019777
Niba149out 24, 20103827jan 25, 20152273
2A02:C7F:C8B:7500:8846:6CC:5280:CCF1159mar 02, 2019775mar 02, 2019775
DanMag168dez 01, 20161597jan 05, 20171562
Fohrrs177dez 06, 20142323dez 12, 20142317
Balasch187nov 28, 20171235nov 28, 20171235
Heyyou48196mar 24, 20161849mar 24, 20161849
RedFoxy205jul 28, 20103915mar 10, 20142594


10 usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.


No total 1471 edições foram feitas por usuários anônimos, de um total de 12574 edições ( 11e %)

Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

 < 32 b< 64 b< 128 b< 256 b< 512 b< 1 kb< 2 kb< 4 kb< 8 kb< 16 kb< 32 kb< 64 kb
abr 16, 20211.5%2.4%2.5%3.1%6.8%9.8%35.6%81.5%96.9%99.6%100.0%100.0%
mar 20211.5%2.4%2.5%3.1%6.8%9.8%35.5%81.4%96.8%99.5%99.9%99.9%
fev 20211.5%2.4%2.5%3.1%6.8%9.8%35.5%81.4%96.8%99.5%99.9%99.9%
jan 20211.5%2.4%2.5%3.1%6.8%9.8%35.5%81.4%96.8%99.5%99.9%99.9%
dez 20201.5%2.4%2.5%3.1%6.8%9.8%35.5%81.4%96.8%99.5%99.9%99.9%
nov 20201.5%2.4%2.5%3.1%6.8%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
out 20201.5%2.4%2.5%3.1%6.8%9.8%35.5%81.5%96.9%99.6%100.0%100.0%
set 20201.5%2.4%2.5%3.1%6.8%9.8%35.5%81.4%96.8%99.5%99.9%99.9%
ago 20201.5%2.4%2.4%3.1%6.8%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
jul 20201.5%2.4%2.4%3.1%6.8%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
jun 20201.5%2.4%2.4%3.1%6.8%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
mai 20201.5%2.4%2.4%3.1%6.8%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
abr 20201.5%2.4%2.4%3.1%6.8%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
mar 20201.5%2.4%2.4%3.0%6.7%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
fev 20201.5%2.4%2.4%3.0%6.7%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
jan 20201.5%2.4%2.4%3.0%6.7%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
dez 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
nov 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
out 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.4%96.8%99.5%99.9%99.9%
set 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.7%99.4%99.8%99.8%
ago 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.7%99.4%99.8%99.8%
jul 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.7%99.4%99.8%99.8%
jun 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.7%99.4%99.8%99.8%
mai 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.8%99.5%99.9%99.9%
abr 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.8%99.5%99.9%99.9%
mar 20191.5%2.4%2.4%3.0%6.7%9.8%35.4%81.3%96.8%99.5%99.9%99.9%
fev 20191.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.6%99.8%100.0%100.0%
jan 20191.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.5%99.7%99.9%99.9%
dez 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.5%99.7%99.9%99.9%
nov 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.5%99.7%99.9%99.9%
out 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.5%99.7%99.9%99.9%
set 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.5%99.7%99.9%99.9%
ago 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.5%99.7%99.9%99.9%
jul 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
jun 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
mai 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
abr 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
mar 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
fev 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
jan 20181.3%2.2%2.2%2.8%6.6%9.7%35.5%82.1%97.7%99.7%99.9%99.9%
dez 20171.3%2.2%2.2%2.8%6.6%9.7%35.5%82.2%97.8%99.8%100.0%100.0%
nov 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
out 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
set 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
ago 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
jul 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
jun 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
mai 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
abr 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
mar 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
fev 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.3%98.0%99.9%100.0%100.0%
jan 20171.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%98.0%99.9%100.0%100.0%
dez 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%98.0%99.9%100.0%100.0%
nov 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%97.9%99.8%100.0%100.0%
out 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%97.9%99.8%100.0%100.0%
set 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%97.9%99.8%100.0%100.0%
ago 20161.3%2.2%2.2%2.8%6.6%9.7%35.6%82.3%97.9%99.8%100.0%100.0%
jul 20161.3%2.2%2.2%2.9%6.5%9.5%35.5%82.4%97.9%99.8%100.0%100.0%
jun 20161.3%2.2%2.2%2.8%6.4%9.2%35.3%82.3%97.9%99.8%100.0%100.0%
mai 20161.3%2.2%2.2%2.8%6.4%9.2%35.3%82.4%97.9%99.8%100.0%100.0%
abr 20161.3%2.2%2.2%2.8%6.4%9.2%35.2%82.4%98.0%99.8%100.0%100.0%
mar 20161.3%2.2%2.2%2.8%6.4%9.2%35.2%82.4%98.1%99.9%100.0%100.0%
fev 20161.3%2.2%2.2%2.8%6.4%9.2%35.3%82.2%98.0%99.8%99.9%99.9%
jan 20161.3%2.2%2.2%2.8%6.4%9.2%35.5%82.3%98.0%99.8%99.9%99.9%
dez 20151.3%2.2%2.2%2.9%6.5%9.3%35.7%82.3%97.9%99.7%99.8%99.8%
nov 20151.3%2.3%2.3%3.0%6.7%9.7%36.4%82.7%98.2%100.0%100.0%100.0%
out 20151.3%2.1%2.1%3.0%6.3%9.1%36.4%83.3%98.2%100.0%100.0%100.0%
set 20151.2%1.7%1.7%2.6%5.7%8.7%36.0%83.1%98.3%99.8%99.9%99.9%
ago 20151.2%1.8%1.8%2.8%6.0%9.1%36.5%84.4%99.2%100.0%100.0%100.0%
jul 20151.2%1.8%1.8%2.9%6.1%9.3%36.7%84.8%99.2%100.0%100.0%100.0%
jun 20151.2%1.8%1.8%2.9%6.2%9.5%36.7%84.6%99.0%99.9%100.0%100.0%
mai 20151.1%1.7%1.7%2.7%5.9%9.3%36.8%84.7%99.0%99.9%100.0%100.0%
abr 20151.1%1.7%1.7%2.7%5.8%9.1%36.4%84.6%99.0%100.0%100.0%100.0%
mar 20151.1%1.7%1.7%2.8%6.0%9.5%36.8%85.0%99.1%100.0%100.0%100.0%
fev 20151.3%1.8%1.8%2.8%6.1%9.7%37.2%85.1%99.0%100.0%100.0%100.0%
jan 20151.3%1.8%1.8%2.9%6.2%10.0%38.0%85.8%98.9%100.0%100.0%100.0%
dez 20141.4%2.0%2.0%3.1%6.4%10.5%37.8%85.4%98.7%99.8%99.9%99.9%
nov 20141.4%2.0%2.0%3.3%6.8%11.0%38.0%84.6%98.7%99.9%99.9%99.9%
out 20141.5%2.2%2.2%3.5%6.8%11.4%39.2%85.7%98.9%100.0%100.0%100.0%
set 20141.4%1.8%1.8%3.2%5.3%10.9%40.7%85.1%98.7%100.0%100.0%100.0%
ago 20141.0%1.2%1.2%3.0%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
jul 20141.0%1.2%1.2%3.0%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
jun 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
mai 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
abr 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
mar 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
fev 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
jan 20141.0%1.2%1.2%3.2%5.0%11.3%36.8%83.2%98.8%100.0%100.0%100.0%
dez 20131.0%1.2%1.2%3.2%5.0%11.3%36.8%83.2%98.8%100.0%100.0%100.0%
nov 20131.0%1.2%1.2%3.2%5.0%11.3%37.0%83.2%98.8%100.0%100.0%100.0%
out 20131.0%1.2%1.2%3.2%5.0%11.3%37.0%83.2%98.8%100.0%100.0%100.0%
set 20130.7%0.9%0.9%2.4%4.4%10.6%37.6%81.9%98.1%99.9%99.9%99.9%
ago 20130.8%1.0%1.0%2.6%4.8%11.5%39.8%82.2%98.1%100.0%100.0%100.0%
jul 20130.8%1.0%1.0%2.5%4.8%11.9%41.2%81.1%97.9%100.0%100.0%100.0%
jun 20130.6%0.8%0.8%2.5%4.7%11.6%40.2%80.8%97.6%100.0%100.0%100.0%
mai 20130.2%0.4%0.4%2.4%4.6%11.9%42.1%82.3%97.2%99.9%99.9%99.9%
abr 20130.3%0.6%0.6%2.5%4.9%12.4%44.9%83.9%96.8%99.8%100.0%100.0%
mar 20130.3%0.3%0.3%2.3%5.0%14.6%47.8%84.0%98.3%100.0%100.0%100.0%
fev 20130.5%0.5%0.5%1.5%5.4%19.5%50.2%82.4%96.5%99.9%99.9%99.9%
jan 20130.6%0.6%0.6%1.2%5.5%22.0%51.9%80.6%96.5%100.0%100.0%100.0%
dez 20120.0%0.0%0.0%1.2%9.3%33.7%61.6%76.7%96.5%100.0%100.0%100.0%
nov 20120.0%0.0%0.0%0.0%5.6%22.3%47.3%61.2%91.8%97.4%100.0%100.0%
out 20120.0%0.0%0.0%3.3%6.6%26.6%56.6%66.6%89.9%96.6%99.9%99.9%
set 20120.0%0.0%0.0%4.2%8.4%37.6%75.1%83.4%95.9%95.9%100.0%100.0%
ago 20120.0%0.0%0.0%4.2%8.4%37.6%75.1%83.4%95.9%95.9%100.0%100.0%
jul 20120.0%0.0%0.0%0.0%8.3%37.5%75.0%83.3%95.8%95.8%100.0%100.0%
jun 20120.0%0.0%0.0%0.0%8.3%37.5%75.0%83.3%95.8%95.8%100.0%100.0%
mai 20120.0%0.0%0.0%0.0%8.3%37.5%75.0%83.3%95.8%95.8%100.0%100.0%
abr 20120.0%0.0%0.0%0.0%8.7%39.1%73.9%82.6%95.6%95.6%99.9%99.9%
mar 20120.0%0.0%0.0%0.0%9.1%40.9%72.7%81.8%95.4%95.4%99.9%99.9%
fev 20120.0%0.0%0.0%0.0%9.1%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
jan 20120.0%0.0%0.0%0.0%9.1%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
dez 20110.0%0.0%0.0%0.0%9.1%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
nov 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
out 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
set 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
ago 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
jul 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
jun 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
mai 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
abr 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
mar 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
fev 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
jan 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
dez 20100.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
nov 20100.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
out 20100.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
set 20100.0%0.0%0.0%4.8%14.3%42.9%66.7%81.0%95.3%95.3%100.0%100.0%
ago 20100.0%0.0%0.0%4.8%14.3%42.9%66.7%81.0%95.3%95.3%100.0%100.0%
jul 20100.0%0.0%0.0%4.8%14.3%42.9%66.7%81.0%95.3%95.3%100.0%100.0%
jun 20100.0%0.0%0.0%5.0%10.0%40.0%65.0%80.0%95.0%95.0%100.0%100.0%
mai 20100.0%0.0%0.0%5.0%10.0%40.0%65.0%80.0%95.0%95.0%100.0%100.0%
abr 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
mar 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
fev 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
jan 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
dez 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
nov 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
out 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
set 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
ago 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
jul 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
jun 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
mai 20090.0%0.0%5.9%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%


Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.

categorizados 1
abr 16, 20213,2 k20131,7 k9572112      98%411,1 k5621
mar 20213,2 k20131,7 k9572112      98% 2 1
fev 20213,2 k20131,7 k9572112      98%411,1 k5621
jan 20213,2 k20131,7 k9572112      98% 2 1
dez 20203,2 k20131,7 k9572112      98%411,1 k5621
nov 20203,2 k20131,7 k9572112      98% 2 1
out 20203,2 k20131,7 k9572112      98%411,1 k5611
set 20203,2 k20131,7 k9572112      98% 2 1
ago 20203,2 k20131,7 k9572112      98%411,1 k5611
jul 20203,2 k20131,7 k9572112      98% 2 1
jun 20203,2 k20131,7 k9572112      98%411,1 k5611
mai 20203,2 k20131,7 k9572112      98% 2 1
abr 20203,2 k20131,7 k9572112      98%411,1 k5611
mar 20203,2 k20131,7 k9572112      98% 2 1
fev 20203,2 k20131,7 k9572112      98%411,1 k5611
jan 20203,2 k20131,7 k9572112      98% 2 1
dez 20193,2 k20131,7 k9572112      98%411,1 k5611
nov 20193,2 k20131,7 k9572112      98%411,1 k5611
out 20193,2 k20131,7 k9572112      98%411,1 k5611
set 20193,2 k20131,7 k9572112      98%411,1 k5611
ago 20193,2 k20131,7 k9572112      98%411,1 k5611
jul 20193,2 k20131,7 k9572112      98%411,1 k5611
jun 20193,2 k20131,7 k9572112      98%411,1 k5611
mai 20193,2 k20131,7 k9572112      98%411,1 k5611
abr 20193,2 k20131,7 k9572112      98%411,1 k5611
mar 20193,2 k20131,7 k9572112      98%411,1 k5611
fev 20193,2 k20131,7 k957242      98%411,1 k5611
jan 20193,2 k20131,7 k957242      98%411,1 k5611
dez 20183,2 k20131,7 k957242      98%411,1 k5611
nov 20183,2 k20131,7 k957242      98%411,1 k5611
out 20183,2 k20131,7 k957242      98%411,1 k5611
set 20183,2 k20131,7 k957242      98%411,1 k5611
ago 20183,2 k20131,7 k957242      98%411,1 k5611
jul 20183,2 k20131,7 k957242      98%411,1 k5611
jun 20183,2 k19131,7 k957242      98%411,1 k5611
mai 20183,2 k19131,7 k957242      98%411,1 k5611
abr 20183,2 k19131,7 k957242      98%411,1 k5611
mar 20183,2 k19131,7 k957242      98%411,1 k5611
fev 20183,2 k19131,7 k957242      98%411,1 k5611
jan 20183,2 k19131,7 k957242      98%411,1 k5611
dez 20173,2 k19131,7 k957242      98%411,1 k5611
nov 20173,2 k19131,7 k957242      98%411,1 k5611
out 20173,2 k19131,7 k957242      98%411,1 k5611
set 20173,2 k19131,7 k957242      98%411,1 k5611
ago 20173,2 k19121,7 k957242      98%411,1 k5611
jul 20173,2 k19121,7 k957242      98%411,1 k5601
jun 20173,2 k19121,7 k957242      98%411,1 k5601
mai 20173,2 k19121,7 k957242      98%401,1 k5561
abr 20173,2 k19121,7 k957242      98%401,1 k5551
mar 20173,2 k19121,7 k957242      98%401,1 k5551
fev 20173,2 k19121,7 k957242      98%381,0 k5551
jan 20173,2 k17121,7 k957242      98%381,0 k5541
dez 20163,2 k17121,7 k957242      98%381,0 k5541
nov 20163,2 k17121,7 k957242      98%381,0 k5541
out 20163,2 k17121,7 k957242      98%381,0 k5501
set 20163,2 k17121,7 k957242      98%381,0 k5351
ago 20163,2 k17121,7 k957242      98%389925341
jul 20163,1 k17121,6 k957242      98%389565061
jun 20163,1 k17121,6 k957242      98%389194951
mai 20163,1 k17121,6 k957242      98%368614701
abr 20163,1 k17121,6 k957242      98%357804401
mar 20163,1 k16121,6 k957242      98%357484291
fev 20163,1 k16121,6 k957242      98%357384251
jan 20163,0 k16121,6 k957242      98%337044141
dez 20153,0 k16121,6 k957242      98%337004141
nov 20152,8 k16121,5 k957242      98%326974061
out 20152,8 k16121,5 k957242      98%326703841
set 20152,6 k16121,4 k943242      98%286323681
ago 20152,3 k16121,3 k943242      98%275893361
jul 20152,2 k16121,2 k942242      98%265423121
jun 20152,1 k15121,2 k942242      98%264722711
mai 20152,0 k15111,2 k942242      98%243942201
abr 20152,0 k15101,1 k942242      98%213541621
mar 20151,9 k14101,1 k741242      98%213541621
fev 20151,8 k13101,1 k737240      98%213541621
jan 20151,7 k13101,0 k737240      98%213541621
dez 20141,6 k1310953734240      98%213541621
nov 20141,5 k1110881730239      98%213541621
out 20141,3 k1110770730239      98%213541611
set 20141,1 k117639728236      98%213541611
ago 2014939116538723236      99%213541611
jul 2014939116538723236      99%213541611
jun 2014939116538723235      99%213541611
mai 2014939116538723235      99%163281431
abr 2014939116538723235      99%142941351
mar 2014939116538723235      99%122581211
fev 2014939116537723235      99%122521151
jan 2014938106537723235      99%82201001
dez 2013938106537723235      99%5185861
nov 2013938106537723235      99%5138571
out 2013936106537723235      99%585371
set 2013819106488721230      99%260281
ago 201377596444721230      99% 25151
jul 201373996392721230      99% 891
jun 201369996380712230      99% 641
mai 201361396329712229      99% 3 1
abr 201355695277712229      99% 3 1
mar 201344085201712228      99% 3 1
fev 201326585128712227      99% 3 1
jan 20132018591712225      98% 3 1
dez 2012988541712216      99% 3 1
nov 2012408 1871122      53% 3 1
out 2012368 117722      60% 3 1
set 2012277 47722      75% 3 1
ago 2012277 47722      75% 3 1
jul 2012277 47722      75% 3 1
jun 2012277 47722      75% 3 1
mai 2012277 47722      75% 3 1
abr 2012267 47722      74% 3 1
mar 2012257 47722      73% 3 1
fev 2012257 47722      77% 3 1
jan 2012257 47722      77% 3 1
dez 2011257 47722      77%411,1 k5641
nov 2011257 47722      77% 3 1
out 2011257 47722      77%411,1 k5641
set 2011257 47722      73% 3 1
ago 2011257 47722      77%411,1 k5641
jul 2011256 47722      77% 3 1
jun 2011256 47722      77%411,1 k5641
mai 2011256 47722      77% 3 1
abr 2011256 45722      77%411,1 k5641
mar 2011256 45722      77% 3 1
fev 2011255 45722      77%411,1 k5641
jan 2011255 45722      77% 3 1
dez 2010255 45722      77%411,1 k5641
nov 2010255 45722      77% 3 1
out 2010255 45722      77%411,1 k5641
set 2010245 45722      76% 3 1
ago 2010245 45722      76%411,1 k5641
jul 2010245 45722      76% 3 1
jun 2010235 35722      75%411,1 k5641
mai 2010235 35722      75% 3 1
abr 2010205 35722      82%411,1 k5621
mar 2010205 35722      82% 2 1
fev 2010204 35722      82%411,1 k5621
jan 2010204 35722      82% 2 1
dez 2009204 35722      82%411,1 k5621
nov 2009204 35722      82% 2 1
out 2009204 35722      82%411,1 k5621
set 2009204 34622      82% 2 1
ago 2009204 34622      82%411,1 k5621
jul 2009204 34622      82% 2 1
jun 2009204 34522      82%411,1 k5621
mai 2009202 34522      82% 2 1


46 most edited articles (> 25 edits)

316100%3 WikiFur:Segnalazioni2.0 Mb  
16130%29Cheap Thrills2.1 Mb  
11034%26Rango (film)1.1 Mb  
8580%68Pagina principale< 1 Mb  
8398%62Furry< 1 Mb  
7585%22Sam e Max< 1 Mb  
7478%79Template:Prossimi eventi< 1 Mb  
5754%612Community furry italiana< 1 Mb  
5595%43Sottocultura furry< 1 Mb< 1 Mb  
4898%21Mungyodance (Serie)< 1 Mb  
48100%2 Tom & Jerry< 1 Mb  
4774%25Fritz il Gatto (film)< 1 Mb  
4648%24Sabrina Online< 1 Mb  
4562%28Zampacon< 1 Mb  
4388%82Better Days< 1 Mb  
4360%41Categoria:EPG1.4 Mb  
4168%25Bianca e Bernie nella terra dei canguri< 1 Mb  
3944%24TaleSpin< 1 Mb  
38100%1 WikiFur:Portale comunità< 1 Mb  
38100%7 Categoria:Freeview< 1 Mb  
3759%24Coonskin< 1 Mb  
3697%21Le avventure di Bianca e Bernie< 1 Mb  
3697%21Template:DiNuovo< 1 Mb  
3551%23Tom & Jerry: Il film< 1 Mb  
3569%24Teenage Mutant Ninja Turtles (serie 2012)< 1 Mb  
3491%23Shark Attack< 1 Mb  
3424%25Gli Aristogatti< 1 Mb  
3421%22Caccia al tesoro con Montana< 1 Mb  
3345%416Discussione:Pagina principale< 1 Mb  
3288%22WikiFur:Cosa è WikiFur< 1 Mb  
3190%33Fursona< 1 Mb  
3148%21Street Sharks: Quattro pinne all'orizzonte< 1 Mb  
31100%2 Scodinzola la vita e abbaia l'avventura con Oliver< 1 Mb  
3087%34Bugs Bunny< 1 Mb  
3050%24Darkwing Duck< 1 Mb  
2875%22Dogday< 1 Mb  
2789%23Lugaru: The Rabbit's Foot< 1 Mb  
2781%23Vivisector: Beast inside< 1 Mb  
2737%22SWAT Kats< 1 Mb  
2696%21Sheep, Dog 'N' Wolf< 1 Mb  
2688%21Wacky Wheels< 1 Mb  
2662%24Fievel sbarca in America< 1 Mb  
2596%11Tartarughe Ninja< 1 Mb  
2536%13Quack Pack< 1 Mb  
2544%21Una giungla di stelle per capitan Simian< 1 Mb  



mai 2009

1: 2 wikifurries edited Duckon
2: 2 wikifurries edited Bugs Bunny
3: 2 wikifurries edited Community furry italiana
4: 2 wikifurries edited Mondano
5: 1 wikifurries edited BerliCon

jun 2009

1: 1 wikifurries edited Pagina principale

out 2009

1: 1 wikifurries edited Pagina principale

mai 2010

1: 2 wikifurries edited Sergal
2: 1 wikifurries edited Yiff

jul 2010

1: 1 wikifurries edited FurryItalia

out 2010

1: 1 wikifurries edited Havoc Inc.

abr 2011

1: 1 wikifurries edited Umano

mai 2011

1: 1 wikifurries edited FurryItalia

jun 2011

1: 1 wikifurries edited Pagina principale

ago 2011

1: 1 wikifurries edited

out 2011

1: 1 wikifurries edited BDSM

nov 2011

1: 2 wikifurries edited Pagina principale

dez 2011

1: 1 wikifurries edited Pagina principale

abr 2012

1: 1 wikifurries edited Heat

mai 2012

1: 1 wikifurries edited Genus

out 2012

1: 2 wikifurries edited
2: 1 wikifurries edited Sheep, Dog 'N' Wolf

nov 2012

1: 3 wikifurries edited Pagina principale
2: 2 wikifurries edited Furry
3: 1 wikifurries edited Antropomorfismo

dez 2012

1: 2 wikifurries edited Cruelty
2: 2 wikifurries edited FA: United
3: 2 wikifurries edited Sly Cooper
4: 2 wikifurries edited Okami
5: 1 wikifurries edited Furmeet

jan 2013

1: 2 wikifurries edited Fur Affinity
2: 2 wikifurries edited Musica antropomorfa
3: 2 wikifurries edited Arte antropomorfa
4: 1 wikifurries edited Warrior Cats (serie)

fev 2013

1: 1 wikifurries edited I Misteri di Providence

mar 2013

1: 2 wikifurries edited La Collina dei Conigli (libro)
2: 2 wikifurries edited Redwall (saga)
3: 1 wikifurries edited Vivisector beast inside

abr 2013

1: 2 wikifurries edited Community furry italiana
2: 1 wikifurries edited Rescue Rangers

mai 2013

1: 1 wikifurries edited Il romanzo di Renart

jun 2013

1: 2 wikifurries edited
2: 2 wikifurries edited Flayrah
3: 2 wikifurries edited Bannertail: The Story of a Gray Squirrel
4: 1 wikifurries edited Senseless

jul 2013

1: 1 wikifurries edited Sparkledog

ago 2013

1: 1 wikifurries edited Lucertola

set 2013

1: 1 wikifurries edited Corna

out 2013

1: 2 wikifurries edited Contix
2: 1 wikifurries edited Looney Tunes: Back in Action

nov 2013

1: 1 wikifurries edited Mucca E Pollo

fev 2014

1: 1 wikifurries edited Kinase

mar 2014

1: 1 wikifurries edited Zampacon

set 2014

1: 3 wikifurries edited WikiFur
2: 2 wikifurries edited Le avventure dei Chipmunk
3: 2 wikifurries edited Tom & Jerry Cat-Astrophe
4: 2 wikifurries edited Claw (videogioco)
5: 2 wikifurries edited Dj Darkfox
6: 2 wikifurries edited David Copperfield
7: 2 wikifurries edited Cats Don't Dance
8: 2 wikifurries edited L'occhio del Lupo
9: 2 wikifurries edited Il Gabbiano Jonathan Livingston
10: 2 wikifurries edited Abbaiare Stanca
11: 1 wikifurries edited Jazz Jackrabbit Advance

out 2014

1: 3 wikifurries edited Italian Fur Haven
2: 1 wikifurries edited Kangoo

nov 2014

1: 1 wikifurries edited Amarillo

dez 2014

1: 2 wikifurries edited Fohrrs
2: 2 wikifurries edited Kinase
3: 1 wikifurries edited Garurumon

jan 2015

1: 2 wikifurries edited Arty Stu
2: 1 wikifurries edited Jungle Cubs

fev 2015

1: 1 wikifurries edited Animal Crackers

mar 2015

1: 2 wikifurries edited Escofal
2: 2 wikifurries edited Zampacon
3: 1 wikifurries edited Pallino

abr 2015

1: 2 wikifurries edited Kimba (personaggio)
2: 2 wikifurries edited Lakeside Furs
3: 2 wikifurries edited Convention
4: 1 wikifurries edited Artist alley

mai 2015

1: 1 wikifurries edited Post-con depression

jun 2015

1: 2 wikifurries edited Basket Case
2: 1 wikifurries edited Captain Simian & the Space Monkeys

jul 2015

1: 2 wikifurries edited La banda del Rock
2: 2 wikifurries edited Le nuove avventure di Charlie
3: 2 wikifurries edited Charlie: Anche i cani vanno in Paradiso
4: 2 wikifurries edited Beethoven (film)
5: 1 wikifurries edited Duckman

ago 2015

1: 1 wikifurries edited Wolf Children

set 2015

1: 2 wikifurries edited Shinbone Alley
2: 2 wikifurries edited Silverwing
3: 2 wikifurries edited Cani Miliardari
4: 2 wikifurries edited Barnyard Commandos
5: 2 wikifurries edited Donnola
6: 1 wikifurries edited Take Me Up to the Ball Game

out 2015

1: 2 wikifurries edited Alla ricerca della Valle Incantata (film)
2: 2 wikifurries edited Alla ricerca della Valle Incantata (serie film)
3: 2 wikifurries edited Millie the Lovable Monster
4: 2 wikifurries edited Wuffle The Big Nice Wolf
5: 2 wikifurries edited Altermeta
6: 2 wikifurries edited Eckhart
7: 2 wikifurries edited Sandokan
8: 2 wikifurries edited TigerSharks
9: 2 wikifurries edited Un tritone per amico
10: 2 wikifurries edited Angelina Ballerina
11: 2 wikifurries edited Blazing Dragons (serie TV)
12: 2 wikifurries edited Sylvan
13: 2 wikifurries edited I Biskitts
14: 2 wikifurries edited Patrouille 03
15: 2 wikifurries edited Jason and the Heroes of Mount Olympus
16: 2 wikifurries edited Don Coyote e Sancho Panda
17: 2 wikifurries edited The Oddball Couple
18: 2 wikifurries edited The Barkleys
19: 2 wikifurries edited I Cuordileone
20: 2 wikifurries edited Galline alla riscossa
21: 2 wikifurries edited Bun Bun
22: 2 wikifurries edited L'isola del Tesoro
23: 2 wikifurries edited Pups of Liberty: The Boston Tea-Bone Party
24: 2 wikifurries edited Scodinzola la vita e abbaia l'avventura con Oliver
25: 2 wikifurries edited Tom Sawyer

nov 2015

1: 2 wikifurries edited Bradipo
2: 2 wikifurries edited Duck Dodgers
3: 2 wikifurries edited I misteri di Silvestro e Titti
4: 2 wikifurries edited Sonic (serie TV)
5: 2 wikifurries edited Jolly
6: 2 wikifurries edited Tom and Jerry: The Lost Dragon
7: 2 wikifurries edited Tom & Jerry: Avventure giganti
8: 2 wikifurries edited Tom & Jerry e Robin Hood
9: 2 wikifurries edited Tom & Jerry e il mago di Oz
10: 1 wikifurries edited Lama

dez 2015

1: 2 wikifurries edited Teen Wolf (serie TV)
2: 2 wikifurries edited Le avventure di Fievel
3: 2 wikifurries edited Geronimo Stilton (serie TV)
4: 2 wikifurries edited Teenage Mutant Ninja Turtles (serie 2012)
5: 2 wikifurries edited Cherry Ugly
6: 2 wikifurries edited La Pantera Rosa (serie TV)
7: 2 wikifurries edited Tom & Jerry
8: 2 wikifurries edited TaleSpin
9: 2 wikifurries edited Rango (film)
10: 1 wikifurries edited Flipper (serie TV)

jan 2016

1: 2 wikifurries edited James e la pesca gigante (romanzo)
2: 2 wikifurries edited Beethoven (serie TV)
3: 2 wikifurries edited Blazing Dragons (serie TV)
4: 1 wikifurries edited J.J. Grandville

fev 2016

1: 2 wikifurries edited Shark Tale
2: 1 wikifurries edited Ratchet & Clank: Alla ricerca del tesoro

mar 2016

1: 2 wikifurries edited Paperina
2: 1 wikifurries edited Crash Bandicoot: Bakusou! Nitro Kart

abr 2016

1: 2 wikifurries edited Maledetti Scarafaggi
2: 1 wikifurries edited Shinobu

mai 2016

1: 4 wikifurries edited Better Days
2: 1 wikifurries edited Tatino e Tatone

jun 2016

1: 2 wikifurries edited Original Life
2: 2 wikifurries edited Better Days
3: 1 wikifurries edited Snooper e Bla-bla

jul 2016

1: 2 wikifurries edited Iago
2: 2 wikifurries edited Animazione
3: 1 wikifurries edited Gatto Bernardo e Topo Didì

ago 2016

1: 1 wikifurries edited Genghis e Khannie

set 2016

1: 1 wikifurries edited Furries on the road

out 2016

1: 2 wikifurries edited Muttley

nov 2016

1: 1 wikifurries edited Muttley

dez 2016

1: 1 wikifurries edited Furrnion

jan 2017

1: 1 wikifurries edited SPQF

fev 2017

1: 1 wikifurries edited PREQUEL

mar 2017

1: 1 wikifurries edited Scooby-Doo

abr 2017

1: 1 wikifurries edited Housepets!

mai 2017

1: 1 wikifurries edited Pokèmon

jun 2017

1: 1 wikifurries edited Better Days

jul 2017

1: 1 wikifurries edited Dillinger Derringer

nov 2017

1: 1 wikifurries edited Furrnion

jan 2018

1: 1 wikifurries edited Furizon

fev 2018

1: 1 wikifurries edited Grifone

jul 2018

1: 1 wikifurries edited Fursuit Italia

ago 2018

1: 1 wikifurries edited Furizon

set 2018

1: 1 wikifurries edited Donkey Kong Country (serie TV)

fev 2019

1: 1 wikifurries edited Inverno

mar 2019

1: 2 wikifurries edited Boj (TV series)
2: 2 wikifurries edited Big Cook Little Cook
3: 1 wikifurries edited ScotiaCon

abr 2019

1: 1 wikifurries edited Lilli e il vagabondo II - Il cucciolo ribelle

mai 2019

1: 1 wikifurries edited Pets

out 2019

1: 1 wikifurries edited L'avventura italiana di Duca Duck

fev 2020

1: 1 wikifurries edited Tom and Jerry Tales

abr 2020

1: 1 wikifurries edited Jolly

jul 2020

1: 1 wikifurries edited Foghorn Leghorn

out 2020

1: 1 wikifurries edited Bowser

fev 2021

1: 1 wikifurries edited EPG

Estatísticas geradas em Sábado, 17 de abril 2021 from recent database dump files.
Data processed up to Sexta-feira, 16 de abril 2021
This script has been developed for Wikimedia and adapted for WikiFur.
Versão do script:2.3b
Autor:Erik Zachte (Sítio web)

WikiFur site administrator Laurence 'GreenReaper' Parry