WikiFur Statistics it.wikifur.com

Zoom           

 


DataWikifurriesArtigosBase de dadosLigações
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 __A____B____C____D____E____F____G____H____I____J____K____L____M____N____O____P____Q____R____S__
dez 17, 20179   1,8 k1,7 k 6,9290393%64%36,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
dez 2017 ± 9    ± 1,8 k ± 1,7 k  ± 6,9 ± 2903 ± 93% ± 64% ± 5   ± 25 k ± 2,1 k ± 1,8 k ± 4,1 k ± 1,4 k
nov 20179 1 1,8 k1,7 k 6,9290393%64%116,4 Mb821 k25 k2,1 k1,8 k4,1 k1,4 k
out 20179   1,8 k1,7 k 6,9290293%64%176,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
set 20179   1,8 k1,7 k 6,9290093%64%36,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
ago 20179   1,8 k1,7 k 6,9290093%64%16,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
jul 20179   1,8 k1,7 k 6,9290093%64%126,4 Mb820 k25 k2,1 k1,8 k4,1 k1,4 k
jun 20179   1,8 k1,7 k 6,9289593%64%56,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
mai 20179   1,8 k1,7 k 6,9289593%64%386,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
abr 20179   1,8 k1,7 k 6,9289393%64%96,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
mar 2017911 1,8 k1,7 k 6,8289393%64%256,4 Mb818 k25 k2,1 k1,8 k4,1 k1,4 k
fev 20178   1,8 k1,7 k 6,8289293%64%136,4 Mb817 k25 k2,1 k1,8 k4,1 k1,4 k
jan 20178   1,8 k1,7 k 6,8289293%64%76,4 Mb817 k25 k2,1 k1,8 k4,1 k1,4 k
dez 20168 2 1,8 k1,7 k 6,8289293%64%166,4 Mb817 k25 k2,1 k1,8 k4,1 k1,4 k
nov 20168 1 1,8 k1,7 k 6,8289193%64%136,3 Mb816 k25 k2,1 k1,8 k4,1 k1,4 k
out 20168 2 1,8 k1,7 k 6,8289193%64%536,3 Mb816 k25 k2,1 k1,8 k4,1 k1,4 k
set 20168 1 1,8 k1,7 k 6,8289093%64%206,3 Mb813 k25 k2,1 k1,8 k4,1 k1,4 k
ago 20168 2 1,8 k1,7 k 6,8289093%64%576,3 Mb812 k25 k2,1 k1,8 k4,1 k1,4 k
jul 20168 1 1,8 k1,7 k 6,8289093%64%326,3 Mb810 k25 k2,1 k1,8 k4,1 k1,4 k
jun 20168 2 1,8 k1,7 k 6,8290094%65%456,3 Mb809 k25 k2,1 k1,8 k4,1 k1,4 k
mai 2016812 1,8 k1,7 k 6,8289894%65%326,3 Mb809 k25 k2,1 k1,8 k4,1 k1,4 k
abr 20167 1 1,8 k1,7 k 6,8289894%65%906,3 Mb808 k25 k2,1 k1,8 k4,1 k1,4 k
mar 20167 3 1,8 k1,7 k 6,7289194%65%376,3 Mb806 k25 k2,1 k1,8 k4,1 k1,4 k
fev 20167 2 1,7 k1,7 k16,7289094%65%1456,2 Mb802 k25 k2,1 k1,8 k4,0 k1,4 k
jan 20167 2 1,7 k1,7 k16,8289094%64%1006,1 Mb784 k25 k2,1 k1,7 k3,8 k1,3 k
dez 20157 211,7 k1,6 k26,8288494%64%2746,0 Mb771 k24 k2,1 k1,7 k3,7 k1,3 k
nov 20157 211,6 k1,6 k16,9286793%64%4025,7 Mb739 k23 k2,1 k1,6 k3,5 k1,2 k
out 20157 221,6 k1,5 k36,8284194%64%8665,5 Mb714 k23 k2,1 k1,6 k3,3 k1,2 k
set 20157 211,5 k1,5 k46,7284194%64%1,0 k5,1 Mb673 k21 k2,0 k1,5 k3,0 k1,1 k
ago 20157 111,4 k1,3 k16,5274294%64%2914,6 Mb599 k20 k2,0 k1,4 k2,6 k930
jul 201571211,3 k1,3 k16,5272394%63%5434,4 Mb576 k19 k1,9 k1,4 k2,5 k845
jun 20156 111,3 k1,3 k26,2272994%63%2544,3 Mb569 k19 k1,9 k1,4 k2,4 k830
mai 20156 1 1,3 k1,2 k 6,2272994%63%484,2 Mb548 k18 k1,9 k1,3 k2,3 k748
abr 2015612 1,3 k1,2 k16,2273694%64%1034,1 Mb545 k18 k1,8 k1,3 k2,3 k726
mar 20155 111,2 k1,2 k16,2272794%63%8614,1 Mb536 k18 k1,8 k1,3 k2,2 k693
fev 20155 111,2 k1,2 k25,8270994%63%2043,9 Mb513 k17 k1,7 k1,2 k2,1 k634
jan 20155 111,1 k1,1 k35,9268094%62%4263,6 Mb483 k16 k1,6 k1,2 k1,9 k593
dez 20145 211,1 k1,0 k35,9269894%62%3703,4 Mb452 k15 k1,4 k1,1 k1,7 k517
nov 20145 1197494846,0268393%62%4023,1 Mb416 k13 k1,3 k1,0 k1,5 k478
out 20145 1185082656,4263993%61%1,4 k2,7 Mb358 k11 k1,1 k9051,3 k433
set 20145 2170869035,8263695%59%5232,2 Mb298 k8,3 k1,0 k7811,1 k379
ago 20145   605592 5,9274395%63%11,9 Mb265 k6,9 k9266881,0 k334
jul 20145   605592 5,9274395%63%11,9 Mb265 k6,9 k9266881,0 k334
jun 20145   605592 5,9274395%63%11,9 Mb265 k6,9 k9266881,0 k334
mai 20145   605592 5,9274295%63%11,9 Mb265 k6,9 k9266881,0 k334
abr 20145   605592 5,9274295%63%11,9 Mb265 k6,9 k9266881,0 k334
mar 20145 1 605592 5,9274295%63%141,9 Mb265 k6,9 k9256881,0 k334
fev 20145   605592 5,9274295%63%61,9 Mb265 k6,9 k9176881,0 k334
jan 20145   604591 5,9273995%63%61,9 Mb264 k6,9 k917688982334
dez 20135   604591 5,9273995%63%41,9 Mb264 k6,9 k917688982334
nov 20135 1 604591 5,9273995%63%191,9 Mb264 k6,9 k917688982334
out 20135 2160459125,8273895%63%5731,9 Mb264 k6,8 k917688982332
set 20135 1154453315,4279096%62%1431,8 Mb242 k5,6 k881639928275
ago 20135 1 50949815,5276495%60%601,6 Mb225 k5,1 k823591881266
jul 20135 1148147015,7278795%59%4631,6 Mb215 k4,7 k780537866258
jun 20135 1146545524,9284895%60%2591,5 Mb213 k4,2 k772525837234
mai 20135 1141040214,9278295%58%1531,3 Mb183 k3,3 k706463736203
abr 20135 2137236525,0276595%55%2561,2 Mb165 k3,2 k649475700184
mar 2013512130129635,4258295%52%334917 kb125 k2,1 k568322585139
fev 20134 1 20520316,3260995%50%144627 kb86 k1,5 k51122643060
jan 20134 3116416337,0261695%48%345502 kb69 k1,2 k49718035537
dez 20124 21868629,2244491%38%342244 kb34 k5093318916212
nov 20124 2 3636 12,6370994%53%109157 kb21 k294103441243
out 201241213029 11,5337093%43%162139 kb16 k32896361153
set 20123   2423 7,6252792%25%273 kb9,3 k3309519923
ago 20123   2423 7,5252792%25%173 kb9,3 k3309419923
jul 20123   2424 7,5253492%25% 73 kb9,4 k3309419933
jun 20123   2424 7,5253492%25% 73 kb9,4 k3309419933
mai 20123   2424 7,5253492%25%273 kb9,4 k3309419933
abr 20123   2323 7,7257391%26%371 kb9,1 k3089318913
mar 20123   2222 7,9262491%27%170 kb8,9 k3049017903
fev 20123   2222 7,9268891%32% 71 kb9,1 k3109217903
jan 20123   2222 7,9268891%32%271 kb9,1 k3109217903
dez 20113   2222 7,8268991%32%471 kb9,1 k3119117903
nov 20113   2221 7,6268191%32%471 kb9,1 k3119117893
out 20113   2221 7,4268191%32%371 kb9,1 k3119117893
set 20113   2221 7,3268491%32%271 kb9,1 k3119017873
ago 20113   2221 7,2268191%32%171 kb9,1 k3119017893
jul 20113   2221 7,1268191%32%371 kb9,1 k3118917893
jun 20113   2221 7,0268191%32%471 kb9,1 k3118617893
mai 20113   2221 6,8268191%32%371 kb9,1 k3118417893
abr 20113   2221 6,7266186%32%370 kb9,0 k3118217893
mar 20113   2221 6,5266186%32% 70 kb9,0 k3118117893
fev 20113   2221 6,5266186%32%270 kb9,0 k3118117893
jan 20113   2221 6,5266086%32% 70 kb9,0 k3118117883
dez 20103   2221 6,5266086%32%270 kb9,0 k3118117883
nov 20103   2221 6,4265886%32% 70 kb9,0 k3108117873
out 20103   2221 6,4265886%32%270 kb9,0 k3108117873
set 20103   2120 6,6271186%33% 68 kb8,7 k3068016833
ago 20103   2120 6,6271186%33%268 kb8,7 k3068016833
jul 20103   2120 6,5271186%33%468 kb8,7 k3068016833
jun 20103   2019 6,6283090%35%168 kb8,7 k3048015813
mai 2010311 2019 6,5282490%35%2268 kb8,7 k3048015773
abr 20102   1716 6,4318288%41% 65 kb8,3 k2977713753
mar 20102   1716 6,4318288%41% 65 kb8,3 k2977713753
fev 20102   1716 6,4318288%41%365 kb8,3 k2977713753
jan 20102   1716 6,2318288%41%165 kb8,3 k2977413753
dez 20092   1716 6,2318288%41%365 kb8,3 k2977313753
nov 20092   1716 6,0317888%41% 65 kb8,2 k2977113753
out 20092 1 1716 6,0317888%41%665 kb8,2 k2977113753
set 20092   1716 5,6317688%41% 65 kb8,2 k2966613753
ago 20092   1716 5,6317688%41%365 kb8,2 k2966613753
jul 20092   1716 5,5317788%41%165 kb8,2 k2966413753
jun 20092   1716 5,4317788%41%565 kb8,2 k2966313753
mai 2009222 171615,1317188%41%8764 kb8,2 k2966013753
 totalnovosediçõescontagemnovos
por dia
médiamaiores queediçõestamanhopalavrasinternasinterwikiimagemexternasredirecio-
namento
> 5> 100oficial> 200 carediçõesbytes0,5 kb2 kb
 WikifurriesArtigosBase de dadosLigações

x < 0%    0% < x < 25%    25% < x < 75%    75% < x

Wikifurries (usuários registrados)
A = Wikifurries que editaram pelo menos dez vezes desde que chegaram
B = Aumento no número de wikifurries que editaram pelo menos dez vezes desde que chegaram
C = Wikifurries que contribuíram cinco vezes ou mais este mês
D = Wikifurries que contribuíram cem vezes ou mais este mês

Artigos (excluindo páginas de redirecionamento)
E = Artigos que contêm pelo menos uma ligação interna
F = Artigos que contêm pelo menos uma ligação interna e 200 caracteres de texto legível, não contando códigos wiki e html,
      ligações ocultas, etc.; títulos também não contam (outras colunas são baseadas no método oficial de contagem)
G = Novos artigos por dia no mês passado
H = Número médio de revisões por artigo
I = Tamanho médio dos artigos em bytes
J = Porcentagem de artigos com pelo menos 0,5 kb de texto legível (veja F)
K = Porcentagem de artigos com pelo menos 2 kb de texto legível (veja F)

Base de dados
L = Edições no mês passado (incluindo páginas de redirecionamento e editores não registrados)
M = Tamanho combinado de todos os artigos (incluindo páginas de redirecionamento)
N = Total de palavras (excluindo páginas de redirecionamento, códigos html e wiki e ligações ocultas)

Ligações
O = Total de ligações internas (excluindo páginas de redirecionamento, esboços e listas de ligações
P = Total number of links to WikiFur sites in other languages
Q = Total de imagens apresentadas
R = Total de ligações para outros sítios
S = Total de páginas de redirecionamento
 


1 wikifurries recentemente ativos, ordenados por número de contribuições:
posição: somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
Δ = variação da posição nos últimos trinta dias
 

UsuárioEdiçõesPrimeira edição
ArtigosOutros
 posiçãoúltimos
30 dias
totaltotalúltimos
30 dias
datadias
atrás
agoraΔ
Balasch14...77  nov 28, 201719

 

1 bots, ordered by number of contributions
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
ReaperBot188jun 05, 20093117abr 18, 20141339

 

20 wikifurries recentemente ausentes, ordenados por número de contribuições:
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdiçõesPrimeira ediçãoúltima edição
 posiçãototaldatadias
atrás
datadias
atrás
Valery91Thunder19753out 28, 20121876out 15, 2016428
Gringo2556jul 22, 2015878fev 19, 2017300
Escofal3276mai 07, 20102781set 18, 2016455
Ylon469mai 04, 20093149mai 14, 20093139
DonatoToon562mai 19, 2016577out 24, 2016419
GreenReaper647mai 02, 20093150abr 16, 2016609
Contix719mar 08, 20131745out 06, 20131533
BearInMind814abr 19, 2015973abr 19, 2015973
Arvo911mar 18, 2017274mar 20, 2017272
Niba109out 24, 20102611jan 25, 20151057
DanMag118dez 01, 2016381jan 05, 2017346
ReggaeCyp127nov 22, 20141121nov 09, 2015769
Fohrrs137dez 06, 20141107dez 12, 20141101
Heyyou48156mar 24, 2016633mar 24, 2016633
Furizon166dez 01, 2016381dez 02, 2016380
RedFoxy175jul 28, 20102699mar 10, 20141378
Sine185ago 25, 20112306jun 27, 20131634
Kinase194fev 08, 20141408dez 20, 20141093
Jed204jan 16, 20151066jan 16, 20151066
2001:B07:6456:64CC:11D9:C815:165B:ADD7214mai 25, 2016571mai 25, 2016571

 

10 usuários anônimos, ordenados por número de contribuições
somente edições em artigos são contadas, não alterações em páginas de discussão, etc.
 

UsuárioEdições
188.153.25.165410
93.144.29.6458
93.147.185.8548
87.24.199.1633
2.32.138.10227
93.147.180.11524
93.147.181.22623
80.181.97.18522
95.247.36.12122
87.20.23.13020

No total 1283 edições foram feitas por usuários anônimos, de um total de 12284 edições ( 10e %)
 


Artigos que contêm pelo menos uma ligação interna e .. caracteres de texto legível, não contando códigos wiki e html,
ligações ocultas, etc.; títulos também não contam  (excluindo páginas de redirecionamento)

DataArtigos
 < 32 b< 64 b< 128 b< 256 b< 512 b< 1 kb< 2 kb< 4 kb< 8 kb< 16 kb< 32 kb< 64 kb
dez 17, 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
nov 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
out 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
set 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
ago 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
jul 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.8%99.8%100.0%100.0%
jun 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
mai 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
abr 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
mar 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.2%97.9%99.8%100.0%100.0%
fev 20171.3%2.2%2.2%2.8%6.6%9.7%35.6%82.3%98.0%99.9%100.0%100.0%
jan 20171.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%98.0%99.9%100.0%100.0%
dez 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%98.0%99.9%100.0%100.0%
nov 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%97.9%99.8%100.0%100.0%
out 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%97.9%99.8%100.0%100.0%
set 20161.3%2.2%2.2%2.8%6.6%9.7%35.7%82.3%97.9%99.8%100.0%100.0%
ago 20161.3%2.2%2.2%2.8%6.6%9.7%35.6%82.3%97.9%99.8%100.0%100.0%
jul 20161.3%2.2%2.2%2.9%6.5%9.5%35.5%82.4%97.9%99.8%100.0%100.0%
jun 20161.3%2.2%2.2%2.8%6.4%9.2%35.3%82.3%97.9%99.8%100.0%100.0%
mai 20161.3%2.2%2.2%2.8%6.4%9.2%35.3%82.4%97.9%99.8%100.0%100.0%
abr 20161.3%2.2%2.2%2.8%6.4%9.2%35.2%82.4%98.0%99.8%100.0%100.0%
mar 20161.3%2.2%2.2%2.8%6.4%9.2%35.2%82.4%98.1%99.9%100.0%100.0%
fev 20161.3%2.2%2.2%2.8%6.4%9.2%35.3%82.2%98.0%99.8%99.9%99.9%
jan 20161.3%2.2%2.2%2.8%6.4%9.2%35.5%82.3%98.0%99.8%99.9%99.9%
dez 20151.3%2.2%2.2%2.9%6.5%9.3%35.7%82.3%97.9%99.7%99.8%99.8%
nov 20151.3%2.3%2.3%3.0%6.7%9.7%36.4%82.7%98.2%100.0%100.0%100.0%
out 20151.3%2.1%2.1%3.0%6.3%9.1%36.4%83.3%98.2%100.0%100.0%100.0%
set 20151.2%1.7%1.7%2.6%5.7%8.7%36.0%83.1%98.3%99.8%99.9%99.9%
ago 20151.2%1.8%1.8%2.8%6.0%9.1%36.5%84.4%99.2%100.0%100.0%100.0%
jul 20151.2%1.8%1.8%2.9%6.1%9.3%36.7%84.8%99.2%100.0%100.0%100.0%
jun 20151.2%1.8%1.8%2.9%6.2%9.5%36.7%84.6%99.0%99.9%100.0%100.0%
mai 20151.1%1.7%1.7%2.7%5.9%9.3%36.8%84.7%99.0%99.9%100.0%100.0%
abr 20151.1%1.7%1.7%2.7%5.8%9.1%36.4%84.6%99.0%100.0%100.0%100.0%
mar 20151.1%1.7%1.7%2.8%6.0%9.5%36.8%85.0%99.1%100.0%100.0%100.0%
fev 20151.3%1.8%1.8%2.8%6.1%9.7%37.2%85.1%99.0%100.0%100.0%100.0%
jan 20151.3%1.8%1.8%2.9%6.2%10.0%38.0%85.8%98.9%100.0%100.0%100.0%
dez 20141.4%2.0%2.0%3.1%6.4%10.5%37.8%85.4%98.7%99.8%99.9%99.9%
nov 20141.4%2.0%2.0%3.3%6.8%11.0%38.0%84.6%98.7%99.9%99.9%99.9%
out 20141.5%2.2%2.2%3.5%6.8%11.4%39.2%85.7%98.9%100.0%100.0%100.0%
set 20141.4%1.8%1.8%3.2%5.3%10.9%40.7%85.1%98.7%100.0%100.0%100.0%
ago 20141.0%1.2%1.2%3.0%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
jul 20141.0%1.2%1.2%3.0%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
jun 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
mai 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
abr 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
mar 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
fev 20141.0%1.2%1.2%3.2%5.0%11.3%36.9%83.2%98.7%100.0%100.0%100.0%
jan 20141.0%1.2%1.2%3.2%5.0%11.3%36.8%83.2%98.8%100.0%100.0%100.0%
dez 20131.0%1.2%1.2%3.2%5.0%11.3%36.8%83.2%98.8%100.0%100.0%100.0%
nov 20131.0%1.2%1.2%3.2%5.0%11.3%37.0%83.2%98.8%100.0%100.0%100.0%
out 20131.0%1.2%1.2%3.2%5.0%11.3%37.0%83.2%98.8%100.0%100.0%100.0%
set 20130.7%0.9%0.9%2.4%4.4%10.6%37.6%81.9%98.1%99.9%99.9%99.9%
ago 20130.8%1.0%1.0%2.6%4.8%11.5%39.8%82.2%98.1%100.0%100.0%100.0%
jul 20130.8%1.0%1.0%2.5%4.8%11.9%41.2%81.1%97.9%100.0%100.0%100.0%
jun 20130.6%0.8%0.8%2.5%4.7%11.6%40.2%80.8%97.6%100.0%100.0%100.0%
mai 20130.2%0.4%0.4%2.4%4.6%11.9%42.1%82.3%97.2%99.9%99.9%99.9%
abr 20130.3%0.6%0.6%2.5%4.9%12.4%44.9%83.9%96.8%99.8%100.0%100.0%
mar 20130.3%0.3%0.3%2.3%5.0%14.6%47.8%84.0%98.3%100.0%100.0%100.0%
fev 20130.5%0.5%0.5%1.5%5.4%19.5%50.2%82.4%96.5%99.9%99.9%99.9%
jan 20130.6%0.6%0.6%1.2%5.5%22.0%51.9%80.6%96.5%100.0%100.0%100.0%
dez 20120.0%0.0%0.0%1.2%9.3%33.7%61.6%76.7%96.5%100.0%100.0%100.0%
nov 20120.0%0.0%0.0%0.0%5.6%22.3%47.3%61.2%91.8%97.4%100.0%100.0%
out 20120.0%0.0%0.0%3.3%6.6%26.6%56.6%66.6%89.9%96.6%99.9%99.9%
set 20120.0%0.0%0.0%4.2%8.4%37.6%75.1%83.4%95.9%95.9%100.0%100.0%
ago 20120.0%0.0%0.0%4.2%8.4%37.6%75.1%83.4%95.9%95.9%100.0%100.0%
jul 20120.0%0.0%0.0%0.0%8.3%37.5%75.0%83.3%95.8%95.8%100.0%100.0%
jun 20120.0%0.0%0.0%0.0%8.3%37.5%75.0%83.3%95.8%95.8%100.0%100.0%
mai 20120.0%0.0%0.0%0.0%8.3%37.5%75.0%83.3%95.8%95.8%100.0%100.0%
abr 20120.0%0.0%0.0%0.0%8.7%39.1%73.9%82.6%95.6%95.6%99.9%99.9%
mar 20120.0%0.0%0.0%0.0%9.1%40.9%72.7%81.8%95.4%95.4%99.9%99.9%
fev 20120.0%0.0%0.0%0.0%9.1%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
jan 20120.0%0.0%0.0%0.0%9.1%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
dez 20110.0%0.0%0.0%0.0%9.1%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
nov 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
out 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
set 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
ago 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
jul 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
jun 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
mai 20110.0%0.0%0.0%4.5%9.0%40.8%68.1%81.7%95.3%95.3%99.8%99.8%
abr 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
mar 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
fev 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
jan 20110.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
dez 20100.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
nov 20100.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
out 20100.0%0.0%0.0%4.5%13.6%40.9%68.2%81.8%95.4%95.4%99.9%99.9%
set 20100.0%0.0%0.0%4.8%14.3%42.9%66.7%81.0%95.3%95.3%100.0%100.0%
ago 20100.0%0.0%0.0%4.8%14.3%42.9%66.7%81.0%95.3%95.3%100.0%100.0%
jul 20100.0%0.0%0.0%4.8%14.3%42.9%66.7%81.0%95.3%95.3%100.0%100.0%
jun 20100.0%0.0%0.0%5.0%10.0%40.0%65.0%80.0%95.0%95.0%100.0%100.0%
mai 20100.0%0.0%0.0%5.0%10.0%40.0%65.0%80.0%95.0%95.0%100.0%100.0%
abr 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
mar 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
fev 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
jan 20100.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
dez 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
nov 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
out 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
set 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
ago 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
jul 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
jun 20090.0%0.0%0.0%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%
mai 20090.0%0.0%5.9%5.9%11.8%35.3%58.8%76.4%94.0%94.0%99.9%99.9%

 

Registros no banco de dados por domínio / Artigos categorizados / Binaries (=namespace 6: images, sound files, etc)

1) Categorias inseridas por predefinição não são detectadas.
 

DataDomínioArtigos
categorizados 1
Binaries
 ArtigoUsuárioProjetoImagemMediaWikiPredefiniçãoAjudaCategoria100102104106108110GifJpgPngSvg
dez 17, 20173,2 k19131,7 k957242      98% 2 1
nov 20173,2 k19131,7 k957242      98% 2 1
out 20173,2 k19131,7 k957242      98% 2 1
set 20173,2 k19131,7 k957242      98% 2 1
ago 20173,2 k19121,7 k957242      98% 2 1
jul 20173,2 k19121,7 k957242      98% 2 1
jun 20173,2 k19121,7 k957242      98% 2 1
mai 20173,2 k19121,7 k957242      98% 2 1
abr 20173,2 k19121,7 k957242      98%411,1 k5611
mar 20173,2 k19121,7 k957242      98%411,1 k5611
fev 20173,2 k19121,7 k957242      98%411,1 k5611
jan 20173,2 k17121,7 k957242      98%411,1 k5611
dez 20163,2 k17121,7 k957242      98%411,1 k5611
nov 20163,2 k17121,7 k957242      98%411,1 k5611
out 20163,2 k17121,7 k957242      98%411,1 k5611
set 20163,2 k17121,7 k957242      98%411,1 k5611
ago 20163,2 k17121,7 k957242      98%411,1 k5611
jul 20163,1 k17121,6 k957242      98%411,1 k5611
jun 20163,1 k17121,6 k957242      98%411,1 k5611
mai 20163,1 k17121,6 k957242      98%411,1 k5611
abr 20163,1 k17121,6 k957242      98%411,1 k5611
mar 20163,1 k16121,6 k957242      98%411,1 k5601
fev 20163,1 k16121,6 k957242      98%411,1 k5601
jan 20163,0 k16121,6 k957242      98%401,1 k5561
dez 20153,0 k16121,6 k957242      98%401,1 k5551
nov 20152,8 k16121,5 k957242      98%401,1 k5551
out 20152,8 k16121,5 k957242      98%381,0 k5551
set 20152,6 k16121,4 k943242      98%381,0 k5541
ago 20152,3 k16121,3 k943242      98%381,0 k5541
jul 20152,2 k16121,2 k942242      98%381,0 k5541
jun 20152,1 k15121,2 k942242      98%381,0 k5501
mai 20152,0 k15111,2 k942242      98%381,0 k5351
abr 20152,0 k15101,1 k942242      98%389925341
mar 20151,9 k14101,1 k741242      98%389565061
fev 20151,8 k13101,1 k737240      98%389194951
jan 20151,7 k13101,0 k737240      98%368614701
dez 20141,6 k1310953734240      98%357804401
nov 20141,5 k1110881730239      98%357484291
out 20141,3 k1110770730239      98%357384251
set 20141,1 k117639728236      98%337044141
ago 2014939116538723236      99%337004141
jul 2014939116538723236      99%326974061
jun 2014939116538723235      99%326703841
mai 2014939116538723235      99%286323681
abr 2014939116538723235      99%275893361
mar 2014939116538723235      99%265423121
fev 2014939116537723235      99%264722711
jan 2014938106537723235      99%243942201
dez 2013938106537723235      99%213541621
nov 2013938106537723235      99%213541621
out 2013936106537723235      99%213541621
set 2013819106488721230      99%213541621
ago 201377596444721230      99%213541621
jul 201373996392721230      99%213541621
jun 201369996380712230      99%213541611
mai 201361396329712229      99%213541611
abr 201355695277712229      99%213541611
mar 201344085201712228      99%213541611
fev 201326585128712227      99%213541611
jan 20132018591712225      98%163281431
dez 2012988541712216      99%142941351
nov 2012408 1871122      53%122581211
out 2012368 117722      60%122521151
set 2012277 47722      75%82201001
ago 2012277 47722      75%5185861
jul 2012277 47722      75%5138571
jun 2012277 47722      75%585371
mai 2012277 47722      75%260281
abr 2012267 47722      74% 25151
mar 2012257 47722      73% 891
fev 2012257 47722      77% 641
jan 2012257 47722      77% 3 1
dez 2011257 47722      77% 3 1
nov 2011257 47722      77% 3 1
out 2011257 47722      77% 3 1
set 2011257 47722      73% 3 1
ago 2011257 47722      77% 3 1
jul 2011256 47722      77% 3 1
jun 2011256 47722      77% 3 1
mai 2011256 47722      77% 3 1
abr 2011256 45722      77% 3 1
mar 2011256 45722      77% 3 1
fev 2011255 45722      77% 3 1
jan 2011255 45722      77% 3 1
dez 2010255 45722      77% 3 1
nov 2010255 45722      77% 3 1
out 2010255 45722      77% 3 1
set 2010245 45722      76% 3 1
ago 2010245 45722      76% 3 1
jul 2010245 45722      76% 3 1
jun 2010235 35722      75% 3 1
mai 2010235 35722      75% 3 1
abr 2010205 35722      82% 3 1
mar 2010205 35722      82% 3 1
fev 2010204 35722      82% 3 1
jan 2010204 35722      82% 3 1
dez 2009204 35722      82% 3 1
nov 2009204 35722      82% 3 1
out 2009204 35722      82% 2 1
set 2009204 34622      82% 2 1
ago 2009204 34622      82% 2 1
jul 2009204 34622      82% 2 1
jun 2009204 34522      82% 2 1
mai 2009202 34522      82% 2 1

 

42 most edited articles (> 25 edits)
 

EdiçõesWikifurriesArtigosArchived
TotalReg.Reg.Unreg.
308100%2 WikiFur:Segnalazioni1.9 Mb  
16031%28Cheap Thrills2.0 Mb  
10535%24Rango (film)1.0 Mb  
8480%68Pagina principale< 1 Mb  
8398%62Furry< 1 Mb  
7585%22Sam e Max< 1 Mb  
7177%79Template:Prossimi eventi< 1 Mb  
5754%612Community furry italiana< 1 Mb  
5595%43Sottocultura furry< 1 Mb  
5491%44Furrymania.it< 1 Mb  
4898%21Mungyodance (Serie)< 1 Mb  
48100%2 Tom & Jerry< 1 Mb  
4676%24Fritz il Gatto (film)< 1 Mb  
4549%23Sabrina Online< 1 Mb  
4464%27Zampacon< 1 Mb  
4388%82Better Days< 1 Mb  
4168%25Bianca e Bernie nella terra dei canguri< 1 Mb  
38100%1 WikiFur:Portale comunità< 1 Mb  
3759%24Coonskin< 1 Mb  
3697%21Le avventure di Bianca e Bernie< 1 Mb  
3549%23TaleSpin< 1 Mb  
3597%11Template:DiNuovo< 1 Mb  
3491%23Shark Attack< 1 Mb  
3421%22Caccia al tesoro con Montana< 1 Mb  
3288%22WikiFur:Cosa è WikiFur< 1 Mb  
3256%21Tom & Jerry: Il film< 1 Mb  
3190%33Fursona< 1 Mb  
3148%21Street Sharks: Quattro pinne all'orizzonte< 1 Mb  
31100%2 Scodinzola la vita e abbaia l'avventura con Oliver< 1 Mb  
2948%313Discussione:Pagina principale< 1 Mb  
2990%33Bugs Bunny< 1 Mb  
2928%24Gli Aristogatti< 1 Mb  
2952%23Darkwing Duck< 1 Mb  
2983%22Teenage Mutant Ninja Turtles (serie 2012)< 1 Mb  
2875%22Dogday< 1 Mb  
2789%23Lugaru: The Rabbit's Foot< 1 Mb  
2781%23Vivisector: Beast inside< 1 Mb  
2696%21Sheep, Dog 'N' Wolf< 1 Mb  
2688%21Wacky Wheels< 1 Mb  
2596%11Tartarughe Ninja< 1 Mb  
2536%13Quack Pack< 1 Mb  
2544%21Una giungla di stelle per capitan Simian< 1 Mb  

 

ZeitGeist

mai 2009

1: 2 wikifurries edited Duckon
2: 2 wikifurries edited Bugs Bunny
3: 2 wikifurries edited Community furry italiana
4: 2 wikifurries edited Mondano
5: 1 wikifurries edited BerliCon

jun 2009

1: 1 wikifurries edited Pagina principale

out 2009

1: 1 wikifurries edited Pagina principale

mai 2010

1: 2 wikifurries edited Sergal
2: 1 wikifurries edited Yiff

jul 2010

1: 1 wikifurries edited FurryItalia

out 2010

1: 1 wikifurries edited Havoc Inc.

abr 2011

1: 1 wikifurries edited Umano

mai 2011

1: 1 wikifurries edited FurryItalia

jun 2011

1: 1 wikifurries edited Pagina principale

ago 2011

1: 1 wikifurries edited Furrymania.it

out 2011

1: 1 wikifurries edited BDSM

nov 2011

1: 2 wikifurries edited Pagina principale

dez 2011

1: 1 wikifurries edited Pagina principale

abr 2012

1: 1 wikifurries edited Heat

mai 2012

1: 1 wikifurries edited Genus

out 2012

1: 2 wikifurries edited Furrymania.it
2: 1 wikifurries edited Sheep, Dog 'N' Wolf

nov 2012

1: 3 wikifurries edited Pagina principale
2: 2 wikifurries edited Furry
3: 1 wikifurries edited Antropomorfismo

dez 2012

1: 2 wikifurries edited Cruelty
2: 2 wikifurries edited FA: United
3: 2 wikifurries edited Sly Cooper
4: 2 wikifurries edited Okami
5: 1 wikifurries edited Furmeet

jan 2013

1: 2 wikifurries edited Fur Affinity
2: 2 wikifurries edited Musica antropomorfa
3: 2 wikifurries edited Arte antropomorfa
4: 1 wikifurries edited Warrior Cats (serie)

fev 2013

1: 1 wikifurries edited I Misteri di Providence

mar 2013

1: 2 wikifurries edited La Collina dei Conigli (libro)
2: 2 wikifurries edited Redwall (saga)
3: 1 wikifurries edited Vivisector beast inside

abr 2013

1: 2 wikifurries edited Community furry italiana
2: 1 wikifurries edited Rescue Rangers

mai 2013

1: 1 wikifurries edited Il romanzo di Renart

jun 2013

1: 2 wikifurries edited Furry.it
2: 2 wikifurries edited Flayrah
3: 2 wikifurries edited Bannertail: The Story of a Gray Squirrel
4: 1 wikifurries edited Senseless

jul 2013

1: 1 wikifurries edited Sparkledog

ago 2013

1: 1 wikifurries edited Lucertola

set 2013

1: 1 wikifurries edited Corna

out 2013

1: 2 wikifurries edited Contix
2: 1 wikifurries edited Looney Tunes: Back in Action

nov 2013

1: 1 wikifurries edited Mucca E Pollo

fev 2014

1: 1 wikifurries edited Kinase

mar 2014

1: 1 wikifurries edited Zampacon

set 2014

1: 3 wikifurries edited WikiFur
2: 2 wikifurries edited Le avventure dei Chipmunk
3: 2 wikifurries edited Tom & Jerry Cat-Astrophe
4: 2 wikifurries edited Claw (videogioco)
5: 2 wikifurries edited Dj Darkfox
6: 2 wikifurries edited David Copperfield
7: 2 wikifurries edited Cats Don't Dance
8: 2 wikifurries edited L'occhio del Lupo
9: 2 wikifurries edited Il Gabbiano Jonathan Livingston
10: 2 wikifurries edited Abbaiare Stanca
11: 1 wikifurries edited Jazz Jackrabbit Advance

out 2014

1: 3 wikifurries edited Italian Fur Haven
2: 1 wikifurries edited Kangoo

nov 2014

1: 1 wikifurries edited Amarillo

dez 2014

1: 2 wikifurries edited Fohrrs
2: 2 wikifurries edited Kinase
3: 1 wikifurries edited Garurumon

jan 2015

1: 2 wikifurries edited Arty Stu
2: 1 wikifurries edited Jungle Cubs

fev 2015

1: 1 wikifurries edited Animal Crackers

mar 2015

1: 2 wikifurries edited Escofal
2: 2 wikifurries edited Zampacon
3: 1 wikifurries edited Pallino

abr 2015

1: 2 wikifurries edited Kimba (personaggio)
2: 2 wikifurries edited Lakeside Furs
3: 2 wikifurries edited Convention
4: 1 wikifurries edited Artist alley

mai 2015

1: 1 wikifurries edited Post-con depression

jun 2015

1: 2 wikifurries edited Basket Case
2: 1 wikifurries edited Captain Simian & the Space Monkeys

jul 2015

1: 2 wikifurries edited La banda del Rock
2: 2 wikifurries edited Le nuove avventure di Charlie
3: 2 wikifurries edited Charlie: Anche i cani vanno in Paradiso
4: 2 wikifurries edited Beethoven (film)
5: 1 wikifurries edited Duckman

ago 2015

1: 1 wikifurries edited Wolf Children

set 2015

1: 2 wikifurries edited Shinbone Alley
2: 2 wikifurries edited Silverwing
3: 2 wikifurries edited Cani Miliardari
4: 2 wikifurries edited Barnyard Commandos
5: 2 wikifurries edited Donnola
6: 1 wikifurries edited Take Me Up to the Ball Game

out 2015

1: 2 wikifurries edited Alla ricerca della Valle Incantata (film)
2: 2 wikifurries edited Alla ricerca della Valle Incantata (serie film)
3: 2 wikifurries edited Millie the Lovable Monster
4: 2 wikifurries edited Wuffle The Big Nice Wolf
5: 2 wikifurries edited Altermeta
6: 2 wikifurries edited Eckhart
7: 2 wikifurries edited Sandokan
8: 2 wikifurries edited TigerSharks
9: 2 wikifurries edited Un tritone per amico
10: 2 wikifurries edited Angelina Ballerina
11: 2 wikifurries edited Blazing Dragons (serie TV)
12: 2 wikifurries edited Sylvan
13: 2 wikifurries edited I Biskitts
14: 2 wikifurries edited Patrouille 03
15: 2 wikifurries edited Jason and the Heroes of Mount Olympus
16: 2 wikifurries edited Don Coyote e Sancho Panda
17: 2 wikifurries edited The Oddball Couple
18: 2 wikifurries edited The Barkleys
19: 2 wikifurries edited I Cuordileone
20: 2 wikifurries edited Galline alla riscossa
21: 2 wikifurries edited Bun Bun
22: 2 wikifurries edited L'isola del Tesoro
23: 2 wikifurries edited Pups of Liberty: The Boston Tea-Bone Party
24: 2 wikifurries edited Scodinzola la vita e abbaia l'avventura con Oliver
25: 2 wikifurries edited Tom Sawyer

nov 2015

1: 2 wikifurries edited Bradipo
2: 2 wikifurries edited Duck Dodgers
3: 2 wikifurries edited I misteri di Silvestro e Titti
4: 2 wikifurries edited Sonic (serie TV)
5: 2 wikifurries edited Jolly
6: 2 wikifurries edited Tom and Jerry: The Lost Dragon
7: 2 wikifurries edited Tom & Jerry: Avventure giganti
8: 2 wikifurries edited Tom & Jerry e Robin Hood
9: 2 wikifurries edited Tom & Jerry e il mago di Oz
10: 1 wikifurries edited Lama

dez 2015

1: 2 wikifurries edited Teen Wolf (serie TV)
2: 2 wikifurries edited Le avventure di Fievel
3: 2 wikifurries edited Geronimo Stilton (serie TV)
4: 2 wikifurries edited Teenage Mutant Ninja Turtles (serie 2012)
5: 2 wikifurries edited Cherry Ugly
6: 2 wikifurries edited La Pantera Rosa (serie TV)
7: 2 wikifurries edited Tom & Jerry
8: 2 wikifurries edited TaleSpin
9: 2 wikifurries edited Rango (film)
10: 1 wikifurries edited Flipper (serie TV)

jan 2016

1: 2 wikifurries edited James e la pesca gigante (romanzo)
2: 2 wikifurries edited Beethoven (serie TV)
3: 2 wikifurries edited Blazing Dragons (serie TV)
4: 1 wikifurries edited J.J. Grandville

fev 2016

1: 2 wikifurries edited Shark Tale
2: 1 wikifurries edited Ratchet & Clank: Alla ricerca del tesoro

mar 2016

1: 2 wikifurries edited Paperina
2: 1 wikifurries edited Crash Bandicoot: Bakusou! Nitro Kart

abr 2016

1: 2 wikifurries edited Maledetti Scarafaggi
2: 1 wikifurries edited Shinobu

mai 2016

1: 4 wikifurries edited Better Days
2: 1 wikifurries edited Tatino e Tatone

jun 2016

1: 2 wikifurries edited Original Life
2: 2 wikifurries edited Better Days
3: 1 wikifurries edited Snooper e Bla-bla

jul 2016

1: 2 wikifurries edited Iago
2: 2 wikifurries edited Animazione
3: 1 wikifurries edited Gatto Bernardo e Topo Didì

ago 2016

1: 1 wikifurries edited Genghis e Khannie

set 2016

1: 1 wikifurries edited Furries on the road

out 2016

1: 2 wikifurries edited Muttley

nov 2016

1: 1 wikifurries edited Muttley

dez 2016

1: 1 wikifurries edited Furrnion

jan 2017

1: 1 wikifurries edited SPQF

fev 2017

1: 1 wikifurries edited PREQUEL

mar 2017

1: 1 wikifurries edited Scooby-Doo

abr 2017

1: 1 wikifurries edited Housepets!

mai 2017

1: 1 wikifurries edited Pokèmon

jun 2017

1: 1 wikifurries edited Better Days

jul 2017

1: 1 wikifurries edited Dillinger Derringer

nov 2017

1: 1 wikifurries edited Furrnion

Estatísticas geradas em Segunda-feira, 18 de dezembro 2017 from recent database dump files.
Data processed up to Domingo, 17 de dezembro 2017
This script has been developed for Wikimedia and adapted for WikiFur.
Versão do script:2.3b
Autor:Erik Zachte (Sítio web)

WikiFur site administrator Laurence 'GreenReaper' Parry